Scaffold SRS018439_Baylor_scaffold_47627

Overview

Basic Information

• Taxon OID: 7000000681
• Scaffold ID: SRS018439_Baylor_scaffold_47627
• Source Dataset Name: Human tongue dorsum microbial communities from NIH, USA - visit 1, subject 160218816
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: Baylor College of Medicine, J. Craig Venter Institute (JCVI), Washington University in St. Louis
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 7275
• Total Scaffold Genes: 15
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 13 (86.67%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: Not Available (Source: )

Ecosystem & Geography

Source Dataset Ecosystem: Host-Associated → Human → Digestive System → Oral Cavity → Tongue Dorsum → Human → Human Microbial Communities From The National Institute Of Health, Usa, Hmp Production Phase

Source Dataset Sampling Location

• Location Name: National Institutes of Health, USA
• Coordinates

Associated Families

Family	Category	Number of Sequences	3D Structure?
F076191	Metagenome	118	N

Sequences

Protein ID	Family	RBS	Sequence
SRS018439_Baylor_scaffold_47627__gene_63551	F076191	AGGA	MKIIAENPAEEALLWRIKALSDELVNQDNRSTSMPMWTILDNNKAGKDYGAVMYFTGKAAEQHIKENDHHYDNPMISVRSAHDNRELKDIVHLLILAGGNEIPSNHYGVLRDV