Basic Information | |
---|---|
Taxon OID | 7000000665 Open in IMG/M |
Scaffold ID | SRS016037_WUGC_scaffold_28661 Open in IMG/M |
Source Dataset Name | Human tongue dorsum microbial communities from NIH, USA - visit 1, subject 764508039 |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | Baylor College of Medicine, J. Craig Venter Institute (JCVI), Washington University in St. Louis |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 29918 |
Total Scaffold Genes | 48 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 42 (87.50%) |
Novel Protein Genes | 2 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 2 (100.00%) |
Associated Families | 2 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Saccharibacteria → Candidatus Saccharimonia → Candidatus Nanosynbacterales → Candidatus Nanosynbacteraceae → Candidatus Nanosynbacter → unclassified Candidatus Nanosynbacter → Candidatus Nanosynbacter sp. TM7-057 | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Host-Associated → Human → Digestive System → Oral Cavity → Tongue Dorsum → Human → Human Microbial Communities From The National Institute Of Health, Usa, Hmp Production Phase |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | National Institutes of Health, USA | |||||||
Coordinates | Lat. (o) | Long. (o) | Alt. (m) | Depth (m) | Location on Map | |||
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F103430 | Metagenome | 101 | N |
F105376 | Metagenome | 100 | N |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
SRS016037_WUGC_scaffold_28661__gene_43547 | F103430 | AGGAG | MIEQITIKAFIGSNNKTKQLEVDKIISTVNANHEAFTLDYPVIGYWRSEAEETAVLYLSDEQQKVMNTLNELKEVLDQEAIAYQIENDLQLI |
SRS016037_WUGC_scaffold_28661__gene_43550 | F105376 | AGAAG | MNEKPEVSAKEFGALEADVRHIKEGVDKHTITLERIENIAQANVTQSQLKTYIAEHEKESEEKYVKRTEIEGVMNFWSLVTSNLAKLFAIALVGLAIYATNNLIQQNKTVTELQEEVQQTVRRK |
⦗Top⦘ |