Scaffold SRS065310_LANL_scaffold_17602

Overview

Basic Information

• Taxon OID: 7000000656
• Scaffold ID: SRS065310_LANL_scaffold_17602
• Source Dataset Name: Human supragingival plaque microbial communities from NIH, USA - visit 2, subject 764042746
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: Baylor College of Medicine, J. Craig Venter Institute (JCVI), Washington University in St. Louis
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 26996
• Total Scaffold Genes: 32
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 26 (81.25%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Phasmatodea → Verophasmatodea → Areolatae → Bacilloidea → Bacillidae → Bacillinae → Bacillini → Bacillus (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Host-Associated → Human → Digestive System → Oral Cavity → Supragingival Plaque → Human → Human Microbial Communities From The National Institute Of Health, Usa, Hmp Production Phase

Source Dataset Sampling Location

• Location Name: National Institutes of Health, USA
• Coordinates

Associated Families

Family	Category	Number of Sequences	3D Structure?
F054109	Metagenome	140	N

Sequences

Protein ID	Family	RBS	Sequence
SRS065310_LANL_scaffold_17602__gene_19971	F054109	AGG	MFKEKTYMTGRPKSKKGVKVHTAFKIYPKDKERAQIMADKLDMSLSAYINKAVLEKLAHDEKSEASTETN