Scaffold SRS063932_LANL_scaffold_99588

Overview

Basic Information

• Taxon OID: 7000000651
• Scaffold ID: SRS063932_LANL_scaffold_99588
• Source Dataset Name: Human tongue dorsum microbial communities from NIH, USA - visit number 3 of subject 159510762
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: Baylor College of Medicine, J. Craig Venter Institute (JCVI), Washington University in St. Louis
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 2248
• Total Scaffold Genes: 4
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (50.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pasteurellales → Pasteurellaceae (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Host-Associated → Human → Digestive System → Oral Cavity → Tongue Dorsum → Human → Human Microbial Communities From The National Institute Of Health, Usa, Hmp Production Phase

Source Dataset Sampling Location

• Location Name: National Institutes of Health, USA
• Coordinates

Associated Families

Family	Category	Number of Sequences	3D Structure?
F077405	Metagenome	117	N

Sequences

Protein ID	Family	RBS	Sequence
SRS063932_LANL_scaffold_99588__gene_143434	F077405	N/A	PTELFPRLLVAKQRGVFYGFILLCQIKFVKKIFDWLKIIQKQKVRLK