NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold SRS062544_LANL_scaffold_74131

Scaffold SRS062544_LANL_scaffold_74131


Overview

Basic Information
Taxon OID7000000618 Open in IMG/M
Scaffold IDSRS062544_LANL_scaffold_74131 Open in IMG/M
Source Dataset NameHuman tongue dorsum microbial communities from NIH, USA - visit number 3 of subject 763536994
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterBaylor College of Medicine, J. Craig Venter Institute (JCVI), Washington University in St. Louis
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)6121
Total Scaffold Genes6 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)3 (50.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Porphyromonadaceae → Porphyromonas → Porphyromonas gingivalis(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Human → Digestive System → Oral Cavity → Tongue Dorsum → Human → Human Microbial Communities From The National Institute Of Health, Usa, Hmp Production Phase

Source Dataset Sampling Location
Location NameNational Institutes of Health, USA
CoordinatesLat. (o)Long. (o)Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F099454Metagenome103N

Sequences

Protein IDFamilyRBSSequence
SRS062544_LANL_scaffold_74131__gene_99455F099454GGCGGMALTFVLTSCDRLTDEPTLEDRGYYKYFDSTAQHKSFRVVTASGKPYNHKIDWHIIGILDPKSETYLTKKVDTLSNGDLKISYDWVAFIVRENKSVIDVEVQNNETGQDRSVDFVAQDNHKGLASPSMTVIQRAK

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.