| Basic Information | |
|---|---|
| Taxon OID | 7000000563 Open in IMG/M |
| Scaffold ID | C2571380 Open in IMG/M |
| Source Dataset Name | Human tongue dorsum microbial communities from NIH, USA - visit 1, subject 763820215 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | Baylor College of Medicine, J. Craig Venter Institute (JCVI), Washington University in St. Louis |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 520 |
| Total Scaffold Genes | 1 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Host-Associated → Human → Digestive System → Oral Cavity → Tongue Dorsum → Human → Human Microbial Communities From The National Institute Of Health, Usa, Hmp Production Phase |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | USA: Maryland: Natonal Institute of Health | |||||||
| Coordinates | Lat. (o) | 39.0042816 | Long. (o) | -77.1012173 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F063777 | Metagenome | 129 | N |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| C2571380__gene_86799 | F063777 | N/A | SALPPENNSFWMKLLLFLCIPFLFIFAILLLIGWGIYSGISSIISAVKEDFFGIKDKTNIKTSKNILFENEQFKLKKEDYLPDENSQEYKIFDDFCAKSNEHLDDGYIFYKLTDEKSATDLNGAIISEFQEDIGNYILLQNLILEDNQLKNQLISFNKNTGKIIVLADIKDF |
| ⦗Top⦘ |