NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold SRS018443_Baylor_scaffold_65639

Scaffold SRS018443_Baylor_scaffold_65639


Overview

Basic Information
Taxon OID7000000507 Open in IMG/M
Scaffold IDSRS018443_Baylor_scaffold_65639 Open in IMG/M
Source Dataset NameHuman buccal mucosa microbial communities from NIH, USA - visit 1, subject 160218816
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterBaylor College of Medicine, J. Craig Venter Institute (JCVI), Washington University in St. Louis
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)5128
Total Scaffold Genes12 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)11 (91.67%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Human → Digestive System → Oral Cavity → Buccal Mucosa → Human → Human Microbial Communities From The National Institute Of Health, Usa, Hmp Production Phase

Source Dataset Sampling Location
Location NameUSA: Maryland: Natonal Institute of Health
CoordinatesLat. (o)39.0042816Long. (o)-77.1012173Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F101360Metagenome102N

Sequences

Protein IDFamilyRBSSequence
SRS018443_Baylor_scaffold_65639__gene_87668F101360GGAVNKENALRRAAIAAHVAKVASQEKKKALNELMEVMAPGDRSYATVNGEQVGAISVTTATPAYQVTDEQALVRWLEWNKPDAIHRVPAPWFTAKAALDGFIKQTGEIPDGVELVTPTPRISARVSPAQEEVIRELIAIGDISLIEIEGAE

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.