NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold SRS015440_WUGC_scaffold_9401

Scaffold SRS015440_WUGC_scaffold_9401


Overview

Basic Information
Taxon OID7000000469 Open in IMG/M
Scaffold IDSRS015440_WUGC_scaffold_9401 Open in IMG/M
Source Dataset NameHuman supragingival plaque microbial communities from NIH, USA - visit 1, subject 764083206 replicate 1
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterBaylor College of Medicine, J. Craig Venter Institute (JCVI), Washington University in St. Louis
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)857
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Human → Digestive System → Oral Cavity → Supragingival Plaque → Human → Human Microbial Communities From The National Institute Of Health, Usa, Hmp Production Phase

Source Dataset Sampling Location
Location NameUSA: Maryland: Natonal Institute of Health
CoordinatesLat. (o)39.0042816Long. (o)-77.1012173Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F051214Metagenome144N
F071329Metagenome122N

Sequences

Protein IDFamilyRBSSequence
SRS015440_WUGC_scaffold_9401__gene_8347F051214AGGAGMPGKIVAHDTHLRIDTEFIELKDCFEAFRRGVEYKDKNDIDEILVICNAPDIIEYQLKNGDSFIVTYDPIHRIIVMRVFLHDEDITIKPIYIYNNREYQIACEFLRQVMHDKIDLKDEWI
SRS015440_WUGC_scaffold_9401__gene_8348F071329N/AAGMIASKLTKPIVSNANGIAKILLWFGSVGTGVAASAIVAREVEKQFDETVKAVKEARDHIEIED

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.