NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold C3119796

Scaffold C3119796


Overview

Basic Information
Taxon OID7000000324 Open in IMG/M
Scaffold IDC3119796 Open in IMG/M
Source Dataset NameHuman hard palate microbial communities from NIH, USA - visit 2, subject 765560005
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterBaylor College of Medicine, J. Craig Venter Institute (JCVI), Washington University in St. Louis
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)2839
Total Scaffold Genes6 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)5 (83.33%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
All Organisms → Viruses → Predicted Viral(Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Human → Digestive System → Oral Cavity → Hard Palate → Human → Human Microbial Communities From The National Institute Of Health, Usa, Hmp Production Phase

Source Dataset Sampling Location
Location NameUSA: Maryland: Natonal Institute of Health
CoordinatesLat. (o)39.0042816Long. (o)-77.1012173Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F092229Metagenome107N

Sequences

Protein IDFamilyRBSSequence
C3119796__gene_129949F092229AGGAGMNEEYRFKHIPEVVLRNVKFIRENNIDIGTGDDVLECMMDINPVLRQRIYDDYDLAKDVAERRFHTTIEELDLTTILQKCTTRPYIAILNNIYFRYFNSKLIEDMFKLGESTKVLDLAIEYECEYYTVNSAKTNIRRYMQQAYFDKYAADADIISSHRVLSDPQVNAVKSAEFTYDLLVAARSENFNPEMVRDIFLKYGLKTNSSRNLYNRMDNNLSLYYYLEDYLEEYVNTGKFTYGSQEYSTIKEFKYLPLMNVLTQLTKSNPSGYILNHKLELVKG

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.