NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold SRS078176_LANL_scaffold_23494

Scaffold SRS078176_LANL_scaffold_23494


Overview

Basic Information
Taxon OID7000000246 Open in IMG/M
Scaffold IDSRS078176_LANL_scaffold_23494 Open in IMG/M
Source Dataset NameHuman stool microbial communities from NIH, USA - visit number 3 of subject 159227541
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterBaylor College of Medicine, J. Craig Venter Institute (JCVI), Washington University in St. Louis
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)11694
Total Scaffold Genes9 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)5 (55.56%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Human → Digestive System → Large Intestine → Fecal → Human → Human Microbial Communities From The National Institute Of Health, Usa, Hmp Production Phase

Source Dataset Sampling Location
Location NameUSA: Maryland: Natonal Institute of Health
CoordinatesLat. (o)39.0042816Long. (o)-77.1012173Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F050794Metagenome145N

Sequences

Protein IDFamilyRBSSequence
SRS078176_LANL_scaffold_23494__gene_54481F050794AGGMLYTSNYFVKVRQKQLLDHTYSLSRDQAFDYMTEFNKRLSDKVGIKCTMDILLPTDDDNANIIIEHNGIIKKLMKEAEKLELDTDAIEAMMRDLLDELKDDIDLNILIFDVTQLLIKYNLFRLEAITEQEFKNSFVRMDSMNMEIKKLTLSDIKKVVEMIEDRYSYALYMTEEYG

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.