NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold SRS024017_Baylor_scaffold_13161

Scaffold SRS024017_Baylor_scaffold_13161


Overview

Basic Information
Taxon OID7000000211 Open in IMG/M
Scaffold IDSRS024017_Baylor_scaffold_13161 Open in IMG/M
Source Dataset NameHuman buccal mucosa microbial communities from NIH, USA - visit 2, subject 159247771
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterBaylor College of Medicine, J. Craig Venter Institute (JCVI), Washington University in St. Louis
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)2909
Total Scaffold Genes6 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)4 (66.67%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
All Organisms → Viruses(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Human → Digestive System → Oral Cavity → Buccal Mucosa → Human → Human Microbial Communities From The National Institute Of Health, Usa, Hmp Production Phase

Source Dataset Sampling Location
Location NameUSA: Maryland: Natonal Institute of Health
CoordinatesLat. (o)39.0042816Long. (o)-77.1012173Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F105377Metagenome100Y

Sequences

Protein IDFamilyRBSSequence
SRS024017_Baylor_scaffold_13161__gene_12457F105377GAGGVRDFDKLPLLTPEEAFERAWEEGGSDHPVFDRGYRVRGLNSWKAIETLLQQNDVRDIAVASFGLKRFEEILDAIDMLHERGWRLWQTSANVYVDGEKRPVQAIRARYRGI

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.