7000000211: Human buccal mucosa microbial communities from NIH, USA - visit 2, subject 159247771

Overview

Basic Information

• IMG/M Taxon OID: 7000000211
• GOLD Reference (Study | Sequencing Project | Analysis Project): Gs0063646 | Gp0052723 | Ga0027996
• Sample Name: Human buccal mucosa microbial communities from NIH, USA - visit 2, subject 159247771
• Sequencing Status: Permanent Draft
• Sequencing Center: Baylor College of Medicine, J. Craig Venter Institute (JCVI), Washington University in St. Louis
• Published?: N
• Use Policy: Open

Dataset Contents

• Total Genome Size: 16237415
• Sequencing Scaffolds: 2
• Novel Protein Genes: 2
• Associated Families: 2

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
All Organisms → Viruses → Predicted Viral	1
All Organisms → Viruses	1

Ecosystem and Geography

Ecosystem Assignment (GOLD)

• Name: Human Microbial Communities From The National Institute Of Health, Usa, Hmp Production Phase
• Type: Host-Associated
• Taxonomy: Host-Associated → Human → Digestive System → Oral Cavity → Buccal Mucosa → Human → Human Microbial Communities From The National Institute Of Health, Usa, Hmp Production Phase

Alternative Ecosystem Assignments

• Environment Ontology (ENVO): Unclassified
• Earth Microbiome Project Ontology (EMPO): Host-associated → Animal → Animal surface

Location Information

• Location: USA: Maryland: Natonal Institute of Health
• Coordinates
  • Lat. (^o): 39.0042816
  • Long. (^o): -77.1012173
  • Alt. (m): N/A
  • Depth (m): N/A

Associated Families

Family	Category	Number of Sequences	3D Structure?
F105377	Metagenome	100	Y
F105380	Metagenome	100	N

Associated Scaffolds

Scaffold	Taxonomy	Length
C922080	All Organisms → Viruses → Predicted Viral	1108
SRS024017_Baylor_scaffold_13161	All Organisms → Viruses	2909

Sequences

Scaffold ID	Protein ID	Family	Sequence
C922080	C922080__gene_35096	F105380	MEGRQTQYNINLADLDDKISDGIVYADRSGKMIYKFGAKKIIQTAITKDLTITGLDDEFKMDYYSFWVPDIYLISFKSFNPDGGLYLAYHKKDEKHICLTNIWPDSRNQDDTYFPNGKRLETKSICTGRMMDDIDSAEYSAWKNDPVTRASQYINKFINARGNADLDFVNSTLRRKVPNHNTKKFAEFLGSITKEQENVNTYEEFIEWTKTTEWFK
SRS024017_Baylor_scaffold_13161	SRS024017_Baylor_scaffold_13161__gene_12457	F105377	VRDFDKLPLLTPEEAFERAWEEGGSDHPVFDRGYRVRGLNSWKAIETLLQQNDVRDIAVASFGLKRFEEILDAIDMLHERGWRLWQTSANVYVDGEKRPVQAIRARYRGI