Scaffold SRS017013_Baylor_scaffold_14023

Overview

Basic Information

• Taxon OID: 7000000180
• Scaffold ID: SRS017013_Baylor_scaffold_14023
• Source Dataset Name: Human buccal mucosa microbial communities from NIH, USA - visit 1, subject 159490532
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: Baylor College of Medicine, J. Craig Venter Institute (JCVI), Washington University in St. Louis
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 6042
• Total Scaffold Genes: 13
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 10 (76.92%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pasteurellales → Pasteurellaceae (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Host-Associated → Human → Digestive System → Oral Cavity → Buccal Mucosa → Human → Human Microbial Communities From The National Institute Of Health, Usa, Hmp Production Phase

Source Dataset Sampling Location

• Location Name: USA: Maryland: Natonal Institute of Health
• Coordinates
  • Lat. (^o): 39.0042816
  • Long. (^o): -77.1012173

Associated Families

Family	Category	Number of Sequences	3D Structure?
F067846	Metagenome	125	Y

Sequences

Protein ID	Family	RBS	Sequence
SRS017013_Baylor_scaffold_14023__gene_14511	F067846	GAGG	MESLQAQWERKTFNDHDRRCCAEDAYNEAVEREIECIEEDISNGDSEELCKFSEKAFEDDDFVKAIALGNDVEEMRICILKSLAEERIEQRRKDYEKGFILND