NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold SRS043772_WUGC_scaffold_23996

Scaffold SRS043772_WUGC_scaffold_23996


Overview

Basic Information
Taxon OID7000000126 Open in IMG/M
Scaffold IDSRS043772_WUGC_scaffold_23996 Open in IMG/M
Source Dataset NameHuman supragingival plaque microbial communities from NIH, USA - visit 2, subject 763982056
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterBaylor College of Medicine, J. Craig Venter Institute (JCVI), Washington University in St. Louis
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)14985
Total Scaffold Genes16 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)12 (75.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Human → Digestive System → Oral Cavity → Supragingival Plaque → Human → Human Microbial Communities From The National Institute Of Health, Usa, Hmp Production Phase

Source Dataset Sampling Location
Location NameUSA: Maryland: Natonal Institute of Health
CoordinatesLat. (o)39.0042816Long. (o)-77.1012173Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F095632Metagenome105N

Sequences

Protein IDFamilyRBSSequence
SRS043772_WUGC_scaffold_23996__gene_19478F095632N/AMTMSFKETTGYKVVSLVASTSASITAGAVVGALCPPAGVVLTAIYGVGSSVLGTYVGDKAGRQYAETLADAIDSMKKPQTN

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.