NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold SRS014888_WUGC_scaffold_29305

Scaffold SRS014888_WUGC_scaffold_29305


Overview

Basic Information
Taxon OID7000000061 Open in IMG/M
Scaffold IDSRS014888_WUGC_scaffold_29305 Open in IMG/M
Source Dataset NameHuman tongue dorsum microbial communities from NIH, USA - visit 1, subject 763860675
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterBaylor College of Medicine, J. Craig Venter Institute (JCVI), Washington University in St. Louis
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1188
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Human → Digestive System → Oral Cavity → Tongue Dorsum → Human → Human Microbial Communities From The National Institute Of Health, Usa, Hmp Production Phase

Source Dataset Sampling Location
Location NameUSA: Maryland: Natonal Institute of Health
CoordinatesLat. (o)39.0042816Long. (o)-77.1012173Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F103432Metagenome101N

Sequences

Protein IDFamilyRBSSequence
SRS014888_WUGC_scaffold_29305__gene_29400F103432N/AMKLIHSLFSLSLLLALSGLFCTTACQDEAEPTQRAGLISTDSLIHAAKVYDGKAFEHVVSTTAAGLRVSEPRRIVPMLPRQLHVEMEGKTIFRRHNLPSVSAYSFQVLAVGDTIYRQKESDAQFNADLDALFHQSIGIAPRLFGVKELSVLGIDSRGKTRDLGNYSCPLLQGKIKNVNYRTREGVFHEHYEAASVDTFSVKDDWLLNTKAEPSLYVPSFRLLVWDQPAEGCTKLRFTLTLVDGRSLVTEVPLY

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.