Scaffold SRS017814_Baylor_scaffold_1972

Overview

Basic Information

• Taxon OID: 7000000014
• Scaffold ID: SRS017814_Baylor_scaffold_1972
• Source Dataset Name: Human supragingival plaque microbial communities from NIH, USA - visit 1, subject 160603188
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: Baylor College of Medicine, J. Craig Venter Institute (JCVI), Washington University in St. Louis
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1720
• Total Scaffold Genes: 5
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 3 (60.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Spirosoma → Spirosoma linguale (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Host-Associated → Human → Digestive System → Oral Cavity → Supragingival Plaque → Human → Human Microbial Communities From The National Institute Of Health, Usa, Hmp Production Phase

Source Dataset Sampling Location

• Location Name: USA: Maryland: Natonal Institute of Health
• Coordinates
  • Lat. (^o): 39.0042816
  • Long. (^o): -77.1012173

Associated Families

Family	Category	Number of Sequences	3D Structure?
F030786	Metagenome	184	N

Sequences

Protein ID	Family	RBS	Sequence
SRS017814_Baylor_scaffold_1972__gene_2021	F030786	N/A	MKRTRIHKVVFQMLVVMIVTSSLQLLLKNGSATKGGNAMGAKKISLTDIVDGDDSETGVLKVKYFDDGADKIFENNNNRILNTINSQHISYNSQSAEYSKPQLFLLYQSLKVDC