Scaffold Ga0326750_12619

Overview

Basic Information

• Taxon OID: 3300034657
• Scaffold ID: Ga0326750_12619
• Source Dataset Name: Seawater viral communities from Mid-Atlantic Ridge, Atlantic Ocean - 513_2600
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 521
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (100.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → Viruses → environmental samples → uncultured virus (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Unclassified → Unclassified → Filtered Seawater → Extreme Environments Viral Communities From Various Locations

Source Dataset Sampling Location

• Location Name: Atlantic Ocean
• Coordinates
  • Lat. (^o): 13.355
  • Long. (^o): -44.909
  • Depth (m): 2600

Associated Families

Family	Category	Number of Sequences	3D Structure?
F000161	Metagenome / Metatranscriptome	1845	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0326750_12619_121_339	F000161	GAG	MKKFTIEVSHASPAQLTTIALELKIIGNNWEKFGTQWIINGQKLQAPSLRIPGSSRKQQAASDKHHNMTTFI