Scaffold Ga0310146_01458

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0310146_01458

Scaffold Ga0310146_01458

Overview

Basic Information
Taxon OID	3300034524 Open in IMG/M
Scaffold ID	Ga0310146_01458 Open in IMG/M
Source Dataset Name	Fracking water microbial communities from deep shales in Oklahoma, United States - K-7-2
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	19460
Total Scaffold Genes	21 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	1 (4.76%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Fracking Water → Subsurface Microbial Communities From Deep Shales In Ohio And West Virginia, Usa

Source Dataset Sampling Location
Location Name	USA: Oklahoma
Coordinates	Lat. (^o)	35.812	Long. (^o)	-98.262	Alt. (m)		Depth (m)	2943
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F088079	Metagenome / Metatranscriptome	109	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0310146_01458_2711_2971	F088079	N/A	MLTEKAIWLENVPFRNVDEAIGRQNCSVYFVESMFVGQSCTFCTSILGNLAPNPYRMLTRLDVFIHICEIYKVDITFFKSNVVSTK

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.