Scaffold Ga0334947_107573

Overview

Basic Information

• Taxon OID: 3300034251
• Scaffold ID: Ga0334947_107573
• Source Dataset Name: Sub-biocrust soil microbial communities from Mojave Desert, California, United States - 43SMS
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 582
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 3 (100.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → unclassified Thermoleophilaceae → Thermoleophilaceae bacterium (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Soil → Unclassified → Desert → Sub-Biocrust Soil → Soil And Biocrust Microbial Communities From Mojave Desert, California, United States

Source Dataset Sampling Location

• Location Name: USA: California
• Coordinates
  • Lat. (^o): 34.3778
  • Long. (^o): -117.6098

Associated Families

Family	Category	Number of Sequences	3D Structure?
F017106	Metagenome / Metatranscriptome	242	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0334947_107573_292_402	F017106	GGAGG	MAPRRPAVFPEQIGLVIFIAVAMAVGIYFVLRVALA