NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F017106

Metagenome / Metatranscriptome Family F017106

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F017106
Family Type Metagenome / Metatranscriptome
Number of Sequences 242
Average Sequence Length 43 residues
Representative Sequence MWKRLRRRTFAPSRPAVYPDQIGLLIFTVAALAAGIYVVARFLL
Number of Associated Samples 144
Number of Associated Scaffolds 242

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 37.08 %
% of genes near scaffold ends (potentially truncated) 17.77 %
% of genes from short scaffolds (< 2000 bps) 81.82 %
Associated GOLD sequencing projects 137
AlphaFold2 3D model prediction Yes
3D model pTM-score0.56

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (94.215 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil
(25.620 % of family members)
Environment Ontology (ENVO) Unclassified
(27.273 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(52.479 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Transmembrane (alpha-helical) Signal Peptide: No Secondary Structure distribution: α-helix: 44.44%    β-sheet: 0.00%    Coil/Unstructured: 55.56%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.56
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 242 Family Scaffolds
PF02771Acyl-CoA_dh_N 66.94
PF01699Na_Ca_ex 3.72
PF04305DUF455 2.48
PF01965DJ-1_PfpI 1.65
PF03551PadR 0.83
PF03738GSP_synth 0.83
PF10604Polyketide_cyc2 0.41
PF07730HisKA_3 0.41
PF05935Arylsulfotrans 0.41
PF00248Aldo_ket_red 0.41
PF13420Acetyltransf_4 0.41
PF04389Peptidase_M28 0.41
PF08450SGL 0.41
PF132794HBT_2 0.41
PF00903Glyoxalase 0.41
PF05977MFS_3 0.41
PF13278Obsolete Pfam Family 0.41
PF00583Acetyltransf_1 0.41
PF13338AbiEi_4 0.41

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 242 Family Scaffolds
COG1960Acyl-CoA dehydrogenase related to the alkylation response protein AidBLipid transport and metabolism [I] 66.94
COG0387Cation (Ca2+/Na+/K+)/H+ antiporter ChaAInorganic ion transport and metabolism [P] 3.72
COG0530Ca2+/Na+ antiporterInorganic ion transport and metabolism [P] 3.72
COG2833Uncharacterized protein, contains ferritin-like DUF455 domainFunction unknown [S] 2.48
COG0754Glutathionylspermidine synthase, CHAP domainAmino acid transport and metabolism [E] 0.83
COG1695DNA-binding transcriptional regulator, PadR familyTranscription [K] 0.83
COG1733DNA-binding transcriptional regulator, HxlR familyTranscription [K] 0.83
COG1846DNA-binding transcriptional regulator, MarR familyTranscription [K] 0.83
COG2814Predicted arabinose efflux permease AraJ, MFS familyCarbohydrate transport and metabolism [G] 0.41
COG3386Sugar lactone lactonase YvrECarbohydrate transport and metabolism [G] 0.41
COG3391DNA-binding beta-propeller fold protein YncEGeneral function prediction only [R] 0.41
COG3850Signal transduction histidine kinase NarQ, nitrate/nitrite-specificSignal transduction mechanisms [T] 0.41
COG3851Signal transduction histidine kinase UhpB, glucose-6-phosphate specificSignal transduction mechanisms [T] 0.41
COG4564Signal transduction histidine kinaseSignal transduction mechanisms [T] 0.41
COG4585Signal transduction histidine kinase ComPSignal transduction mechanisms [T] 0.41


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms94.21 %
UnclassifiedrootN/A5.79 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2228664022|INPgaii200_c0576669All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei573Open in IMG/M
3300000531|CNBas_1010912All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei556Open in IMG/M
3300002547|JGI24973J35851_1017328All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1014Open in IMG/M
3300002568|C688J35102_118610853All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei577Open in IMG/M
3300002568|C688J35102_118998427All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei624Open in IMG/M
3300002568|C688J35102_120509987All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei1130Open in IMG/M
3300002568|C688J35102_120838726All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei1762Open in IMG/M
3300003373|JGI25407J50210_10000288All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales9100Open in IMG/M
3300003373|JGI25407J50210_10036759All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei1260Open in IMG/M
3300003993|Ga0055468_10211411All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales600Open in IMG/M
3300004081|Ga0063454_101944454All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei519Open in IMG/M
3300004081|Ga0063454_101948344All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia518Open in IMG/M
3300004156|Ga0062589_101671154All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia634Open in IMG/M
3300004463|Ga0063356_103214048All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria704Open in IMG/M
3300005045|Ga0071328_119876All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei2082Open in IMG/M
3300005045|Ga0071328_157203All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei3412Open in IMG/M
3300005332|Ga0066388_105339338All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia652Open in IMG/M
3300005347|Ga0070668_101478695All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia621Open in IMG/M
3300005366|Ga0070659_101699036All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia565Open in IMG/M
3300005441|Ga0070700_100838128All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia744Open in IMG/M
3300005457|Ga0070662_101653562All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia553Open in IMG/M
3300005543|Ga0070672_101490002All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria606Open in IMG/M
3300005578|Ga0068854_101250244All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria667Open in IMG/M
3300005713|Ga0066905_101079167All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia712Open in IMG/M
3300005718|Ga0068866_10534847All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales781Open in IMG/M
3300005937|Ga0081455_10056584All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales3329Open in IMG/M
3300006038|Ga0075365_10480654All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia878Open in IMG/M
3300006048|Ga0075363_100796732All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → Thermoleophilum → Thermoleophilum album574Open in IMG/M
3300006049|Ga0075417_10214631All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia915Open in IMG/M
3300006049|Ga0075417_10514168All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia603Open in IMG/M
3300006049|Ga0075417_10514336All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia603Open in IMG/M
3300006058|Ga0075432_10013101All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia2817Open in IMG/M
3300006844|Ga0075428_100040755All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → Thermoleophilum → Thermoleophilum album5108Open in IMG/M
3300006844|Ga0075428_100772947All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia1021Open in IMG/M
3300006844|Ga0075428_102536032All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia525Open in IMG/M
3300006845|Ga0075421_102041898All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales610Open in IMG/M
3300006846|Ga0075430_100222642All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia1565Open in IMG/M
3300006876|Ga0079217_11188348All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia579Open in IMG/M
3300006894|Ga0079215_10176307All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia1054Open in IMG/M
3300006903|Ga0075426_11124950All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia595Open in IMG/M
3300007790|Ga0105679_10883430All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia1189Open in IMG/M
3300009090|Ga0099827_11176292All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → unclassified Thermoleophilaceae → Thermoleophilaceae bacterium666Open in IMG/M
3300009094|Ga0111539_10544592All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales1352Open in IMG/M
3300009094|Ga0111539_11969473All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia677Open in IMG/M
3300009156|Ga0111538_13115444All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia578Open in IMG/M
3300009553|Ga0105249_13013045All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → unclassified Thermoleophilaceae → Thermoleophilaceae bacterium541Open in IMG/M
3300009789|Ga0126307_10000058All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia59420Open in IMG/M
3300009789|Ga0126307_10000295All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia32299Open in IMG/M
3300009789|Ga0126307_10071052All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → Thermoleophilum → Thermoleophilum album2740Open in IMG/M
3300009789|Ga0126307_10073964All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → Thermoleophilum → Thermoleophilum album2684Open in IMG/M
3300009789|Ga0126307_10074507All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia2674Open in IMG/M
3300009789|Ga0126307_10113008All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → Thermoleophilum → Thermoleophilum album2158Open in IMG/M
3300009789|Ga0126307_10281135All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → Thermoleophilum → Thermoleophilum album1339Open in IMG/M
3300009789|Ga0126307_10342076All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1204Open in IMG/M
3300009789|Ga0126307_11004206All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → Thermoleophilum → Thermoleophilum album674Open in IMG/M
3300009789|Ga0126307_11092269All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → unclassified Thermoleophilaceae → Thermoleophilaceae bacterium645Open in IMG/M
3300009840|Ga0126313_10002181All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia10818Open in IMG/M
3300009840|Ga0126313_10068579All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia2545Open in IMG/M
3300009840|Ga0126313_10143314All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales1797Open in IMG/M
3300009840|Ga0126313_10232171All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia1426Open in IMG/M
3300009840|Ga0126313_10294677All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → Thermoleophilum → Thermoleophilum album1267Open in IMG/M
3300009840|Ga0126313_10499570All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → Thermoleophilum → Thermoleophilum album974Open in IMG/M
3300009840|Ga0126313_10578126Not Available904Open in IMG/M
3300009840|Ga0126313_10659511All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → Thermoleophilum → Thermoleophilum album846Open in IMG/M
3300009840|Ga0126313_10904691All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia720Open in IMG/M
3300009840|Ga0126313_11448043All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → unclassified Thermoleophilaceae → Thermoleophilaceae bacterium570Open in IMG/M
3300009840|Ga0126313_11491235Not Available562Open in IMG/M
3300010036|Ga0126305_10410257All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → Thermoleophilum → Thermoleophilum album894Open in IMG/M
3300010037|Ga0126304_10325430All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia1020Open in IMG/M
3300010038|Ga0126315_10010377All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia4390Open in IMG/M
3300010039|Ga0126309_10018096All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → Thermoleophilum → Thermoleophilum album3037Open in IMG/M
3300010039|Ga0126309_10018748All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → Thermoleophilum → Thermoleophilum album2991Open in IMG/M
3300010039|Ga0126309_10038814All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia2218Open in IMG/M
3300010039|Ga0126309_10087637All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia1577Open in IMG/M
3300010039|Ga0126309_10100307All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia1489Open in IMG/M
3300010039|Ga0126309_10169719All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia1187Open in IMG/M
3300010039|Ga0126309_10249553All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia1005Open in IMG/M
3300010039|Ga0126309_10435679All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia793Open in IMG/M
3300010039|Ga0126309_10791430All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → unclassified Thermoleophilaceae → Thermoleophilaceae bacterium618Open in IMG/M
3300010040|Ga0126308_10049690All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → Thermoleophilum → Thermoleophilum album2431Open in IMG/M
3300010040|Ga0126308_10159541All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia1430Open in IMG/M
3300010040|Ga0126308_10387261All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia931Open in IMG/M
3300010040|Ga0126308_10431947All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia882Open in IMG/M
3300010040|Ga0126308_11214634All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → unclassified Thermoleophilaceae → Thermoleophilaceae bacterium534Open in IMG/M
3300010041|Ga0126312_10000603All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia21968Open in IMG/M
3300010041|Ga0126312_10002093All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia13245Open in IMG/M
3300010041|Ga0126312_10337370All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales1067Open in IMG/M
3300010042|Ga0126314_10561779All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → unclassified Thermoleophilaceae → Thermoleophilaceae bacterium831Open in IMG/M
3300010042|Ga0126314_11016399All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → unclassified Thermoleophilaceae → Thermoleophilaceae bacterium616Open in IMG/M
3300010044|Ga0126310_10026894All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → Thermoleophilum → Thermoleophilum album2970Open in IMG/M
3300010044|Ga0126310_10285843All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1129Open in IMG/M
3300010044|Ga0126310_10355358All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia1029Open in IMG/M
3300010044|Ga0126310_11083008All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia636Open in IMG/M
3300010045|Ga0126311_10266623All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → unclassified Thermoleophilaceae → Thermoleophilaceae bacterium1277Open in IMG/M
3300010045|Ga0126311_10338214All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia1144Open in IMG/M
3300010045|Ga0126311_11305618All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → unclassified Thermoleophilaceae → Thermoleophilaceae bacterium603Open in IMG/M
3300010047|Ga0126382_10248044Not Available1303Open in IMG/M
3300010145|Ga0126321_1275724All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → unclassified Thermoleophilaceae → Thermoleophilaceae bacterium659Open in IMG/M
3300010166|Ga0126306_10010592All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → Thermoleophilum → Thermoleophilum album5830Open in IMG/M
3300010166|Ga0126306_10042275All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia3127Open in IMG/M
3300010166|Ga0126306_10107462All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → Thermoleophilum → Thermoleophilum album2025Open in IMG/M
3300010371|Ga0134125_12774917All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → unclassified Thermoleophilaceae → Thermoleophilaceae bacterium532Open in IMG/M
3300010396|Ga0134126_11332338All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia795Open in IMG/M
3300010399|Ga0134127_11148618All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia842Open in IMG/M
3300010399|Ga0134127_11477965Not Available752Open in IMG/M
3300012021|Ga0120192_10061189All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → unclassified Thermoleophilaceae → Thermoleophilaceae bacterium694Open in IMG/M
3300012022|Ga0120191_10049795All Organisms → cellular organisms → Bacteria726Open in IMG/M
3300012045|Ga0136623_10004531All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → Thermoleophilum → Thermoleophilum album5359Open in IMG/M
3300012092|Ga0136621_1275322All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → unclassified Thermoleophilaceae → Thermoleophilaceae bacterium657Open in IMG/M
3300012093|Ga0136632_10012182All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → Thermoleophilum → Thermoleophilum album3668Open in IMG/M
3300012093|Ga0136632_10022313All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → Thermoleophilum → Thermoleophilum album2822Open in IMG/M
3300012185|Ga0136619_10111297All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1049Open in IMG/M
3300012188|Ga0136618_10143966All Organisms → cellular organisms → Bacteria1046Open in IMG/M
3300012198|Ga0137364_10130825All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia1798Open in IMG/M
3300012198|Ga0137364_11122678All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales591Open in IMG/M
3300012204|Ga0137374_10523093All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → Thermoleophilum → Thermoleophilum album917Open in IMG/M
3300012678|Ga0136615_10115184All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1292Open in IMG/M
3300012680|Ga0136612_10033705All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia2570Open in IMG/M
3300012680|Ga0136612_10048839All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia2127Open in IMG/M
3300012680|Ga0136612_10251526All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia897Open in IMG/M
3300012896|Ga0157303_10182618All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei591Open in IMG/M
3300012897|Ga0157285_10171813All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia661Open in IMG/M
3300012905|Ga0157296_10049256Not Available984Open in IMG/M
3300012907|Ga0157283_10231440All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → unclassified Thermoleophilaceae → Thermoleophilaceae bacterium602Open in IMG/M
3300012911|Ga0157301_10118236All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria803Open in IMG/M
3300012939|Ga0162650_100072924All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → unclassified Thermoleophilaceae → Thermoleophilaceae bacterium587Open in IMG/M
3300013012|Ga0169965_1034450All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1115Open in IMG/M
3300013026|Ga0170681_1006124All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia2997Open in IMG/M
3300013306|Ga0163162_12517912All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → unclassified Thermoleophilaceae → Thermoleophilaceae bacterium592Open in IMG/M
3300013765|Ga0120172_1019268All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia2015Open in IMG/M
3300014263|Ga0075324_1048197All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → unclassified Thermoleophilaceae → Thermoleophilaceae bacterium825Open in IMG/M
3300014271|Ga0075326_1074963All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia928Open in IMG/M
3300014302|Ga0075310_1086261All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → unclassified Thermoleophilaceae → Thermoleophilaceae bacterium651Open in IMG/M
3300014488|Ga0182001_10275195All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → unclassified Thermoleophilaceae → Thermoleophilaceae bacterium666Open in IMG/M
3300015373|Ga0132257_102855079All Organisms → cellular organisms → Bacteria630Open in IMG/M
3300017787|Ga0183260_10101857All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia2078Open in IMG/M
3300017787|Ga0183260_10749667All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia615Open in IMG/M
3300017789|Ga0136617_10068021All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia3121Open in IMG/M
3300017789|Ga0136617_10210520All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → unclassified Thermoleophilaceae → Thermoleophilaceae bacterium1635Open in IMG/M
3300017789|Ga0136617_10559982All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales901Open in IMG/M
3300017789|Ga0136617_10604861All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Sorangiineae → Polyangiaceae → unclassified Polyangiaceae → Polyangiaceae bacterium859Open in IMG/M
3300018028|Ga0184608_10412678All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → unclassified Thermoleophilaceae → Thermoleophilaceae bacterium585Open in IMG/M
3300018061|Ga0184619_10164785All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → Thermoleophilum → Thermoleophilum album1014Open in IMG/M
3300018061|Ga0184619_10398601All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → unclassified Thermoleophilaceae → Thermoleophilaceae bacterium622Open in IMG/M
3300018061|Ga0184619_10506950All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → unclassified Thermoleophilaceae → Thermoleophilaceae bacterium532Open in IMG/M
3300018073|Ga0184624_10121460All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → Thermoleophilum → Thermoleophilum album1132Open in IMG/M
3300018422|Ga0190265_10003263All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia11047Open in IMG/M
3300018422|Ga0190265_10034756All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → Thermoleophilum → Thermoleophilum album4235Open in IMG/M
3300018422|Ga0190265_10402981All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → Thermoleophilum → Thermoleophilum album1466Open in IMG/M
3300018422|Ga0190265_11145943All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia897Open in IMG/M
3300018422|Ga0190265_11547624Not Available776Open in IMG/M
3300018422|Ga0190265_13136598All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria552Open in IMG/M
3300018429|Ga0190272_10322873All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1211Open in IMG/M
3300018429|Ga0190272_10761184All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales884Open in IMG/M
3300018429|Ga0190272_11206442All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia744Open in IMG/M
3300018432|Ga0190275_10533797All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → Thermoleophilum → Thermoleophilum album1212Open in IMG/M
3300018432|Ga0190275_10891144All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → unclassified Thermoleophilaceae → Thermoleophilaceae bacterium957Open in IMG/M
3300018432|Ga0190275_11146528All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia852Open in IMG/M
3300018432|Ga0190275_11452494All Organisms → cellular organisms → Bacteria763Open in IMG/M
3300018432|Ga0190275_11612117All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → unclassified Thermoleophilaceae → Thermoleophilaceae bacterium727Open in IMG/M
3300018432|Ga0190275_12242419All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales624Open in IMG/M
3300018465|Ga0190269_10483022All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia798Open in IMG/M
3300018465|Ga0190269_10800866All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia678Open in IMG/M
3300018466|Ga0190268_10340628All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → Thermoleophilum → Thermoleophilum album927Open in IMG/M
3300018466|Ga0190268_11648954All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei568Open in IMG/M
3300018466|Ga0190268_11662024Not Available567Open in IMG/M
3300018469|Ga0190270_10065006All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → Thermoleophilum → Thermoleophilum album2621Open in IMG/M
3300018469|Ga0190270_10921914All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia893Open in IMG/M
3300018469|Ga0190270_11200952All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales797Open in IMG/M
3300018469|Ga0190270_11562167All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → unclassified Thermoleophilaceae → Thermoleophilaceae bacterium710Open in IMG/M
3300018469|Ga0190270_13425528All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → unclassified Thermoleophilaceae → Thermoleophilaceae bacterium503Open in IMG/M
3300018476|Ga0190274_10383207Not Available1354Open in IMG/M
3300018476|Ga0190274_12646046All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → unclassified Thermoleophilaceae → Thermoleophilaceae bacterium599Open in IMG/M
3300019356|Ga0173481_10332081All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia719Open in IMG/M
3300019356|Ga0173481_10564869All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia592Open in IMG/M
3300019377|Ga0190264_11107548All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia646Open in IMG/M
3300019377|Ga0190264_11227078All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales625Open in IMG/M
3300019767|Ga0190267_11495795All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales520Open in IMG/M
3300019865|Ga0193748_1001264All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia1606Open in IMG/M
3300019884|Ga0193741_1047826All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → Thermoleophilum → Thermoleophilum album1103Open in IMG/M
3300021184|Ga0196959_10110801All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → unclassified Thermoleophilaceae → Thermoleophilaceae bacterium640Open in IMG/M
3300021339|Ga0193706_1004372All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia5515Open in IMG/M
3300022756|Ga0222622_10722203All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia725Open in IMG/M
3300025791|Ga0210115_1019035All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → Thermoleophilum → Thermoleophilum album1565Open in IMG/M
3300025919|Ga0207657_11207382All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → unclassified Thermoleophilaceae → Thermoleophilaceae bacterium575Open in IMG/M
3300025934|Ga0207686_10450461All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → Thermoleophilum → Thermoleophilum album990Open in IMG/M
3300025937|Ga0207669_11166755Not Available652Open in IMG/M
3300025944|Ga0207661_10948055All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → Thermoleophilum → Thermoleophilum album793Open in IMG/M
3300025945|Ga0207679_11579211All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei601Open in IMG/M
3300025949|Ga0207667_12109067All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → unclassified Thermoleophilaceae → Thermoleophilaceae bacterium522Open in IMG/M
3300026075|Ga0207708_10807533All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales808Open in IMG/M
3300026118|Ga0207675_101573955All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → unclassified Thermoleophilaceae → Thermoleophilaceae bacterium678Open in IMG/M
3300027638|Ga0208612_1001662All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia9162Open in IMG/M
3300027691|Ga0209485_1022688Not Available1452Open in IMG/M
3300027873|Ga0209814_10238594All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia787Open in IMG/M
3300027907|Ga0207428_10481260All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → unclassified Thermoleophilaceae → Thermoleophilaceae bacterium903Open in IMG/M
3300027909|Ga0209382_10086280All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia3694Open in IMG/M
3300027909|Ga0209382_10435861All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → Thermoleophilum → Thermoleophilum album1454Open in IMG/M
3300027909|Ga0209382_11655316All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei630Open in IMG/M
3300028589|Ga0247818_10254927All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1160Open in IMG/M
3300028704|Ga0307321_1062498All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei719Open in IMG/M
3300028705|Ga0307276_10004223All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia2261Open in IMG/M
3300028705|Ga0307276_10054564All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → Thermoleophilum → Thermoleophilum album893Open in IMG/M
3300028705|Ga0307276_10106594All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia682Open in IMG/M
3300028707|Ga0307291_1171535All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → unclassified Thermoleophilaceae → Thermoleophilaceae bacterium556Open in IMG/M
3300028713|Ga0307303_10085016All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei710Open in IMG/M
3300028714|Ga0307309_10165412All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia567Open in IMG/M
3300028721|Ga0307315_10034995All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales1356Open in IMG/M
3300028744|Ga0307318_10218708All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Thermoanaerobacterales → Thermoanaerobacteraceae → Carboxydothermus660Open in IMG/M
3300028755|Ga0307316_10182760All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia753Open in IMG/M
3300028814|Ga0307302_10433581All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → unclassified Thermoleophilaceae → Thermoleophilaceae bacterium651Open in IMG/M
3300028876|Ga0307286_10214027All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → unclassified Thermoleophilaceae → Thermoleophilaceae bacterium701Open in IMG/M
3300028878|Ga0307278_10394296All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei609Open in IMG/M
3300028880|Ga0307300_10065567All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia1051Open in IMG/M
3300028889|Ga0247827_10045801All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1975Open in IMG/M
3300030006|Ga0299907_10026681All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → Thermoleophilum → Thermoleophilum album4430Open in IMG/M
3300030006|Ga0299907_11354826All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia503Open in IMG/M
3300030336|Ga0247826_10155087All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia1514Open in IMG/M
3300030336|Ga0247826_10186438All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1406Open in IMG/M
3300030336|Ga0247826_10386260All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → Thermoleophilum → Thermoleophilum album1030Open in IMG/M
3300030511|Ga0268241_10091898All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → unclassified Thermoleophilaceae → Thermoleophilaceae bacterium696Open in IMG/M
3300031152|Ga0307501_10198886All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales572Open in IMG/M
3300031152|Ga0307501_10264486All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → unclassified Thermoleophilaceae → Thermoleophilaceae bacterium517Open in IMG/M
3300031152|Ga0307501_10272035Not Available512Open in IMG/M
3300031226|Ga0307497_10337193All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → unclassified Thermoleophilaceae → Thermoleophilaceae bacterium703Open in IMG/M
3300031229|Ga0299913_10211888All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales1918Open in IMG/M
3300031229|Ga0299913_10449656All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia1275Open in IMG/M
3300031229|Ga0299913_10573567All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → Thermoleophilum → Thermoleophilum album1112Open in IMG/M
3300031229|Ga0299913_11240486All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia704Open in IMG/M
3300031548|Ga0307408_100209191All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → Thermoleophilum → Thermoleophilum album1584Open in IMG/M
3300031731|Ga0307405_10222634All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → Thermoleophilum → Thermoleophilum album1385Open in IMG/M
3300031901|Ga0307406_10943708All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → unclassified Thermoleophilaceae → Thermoleophilaceae bacterium737Open in IMG/M
3300031938|Ga0308175_103274135All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia502Open in IMG/M
3300031995|Ga0307409_100347473All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → Thermoleophilum → Thermoleophilum album1398Open in IMG/M
3300031995|Ga0307409_100476973All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1210Open in IMG/M
3300032005|Ga0307411_10144948All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → Thermoleophilum → Thermoleophilum album1756Open in IMG/M
3300032075|Ga0310890_10453312Not Available965Open in IMG/M
3300032080|Ga0326721_10650272All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → Thermoleophilum → Thermoleophilum album646Open in IMG/M
3300032126|Ga0307415_102488758All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → unclassified Thermoleophilaceae → Thermoleophilaceae bacterium510Open in IMG/M
3300034251|Ga0334947_107573All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → unclassified Thermoleophilaceae → Thermoleophilaceae bacterium582Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil25.62%
Serpentine SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil21.90%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere7.44%
Polar Desert SandEnvironmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert Sand6.61%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil2.89%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere2.89%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil2.48%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment2.07%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil1.65%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil1.65%
PermafrostEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost1.65%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil1.65%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere1.65%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil1.24%
Natural And Restored WetlandsEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands1.24%
Polar DesertEnvironmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert0.83%
Natural And Restored WetlandsEnvironmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands0.83%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.83%
TerrestrialEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial0.83%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil0.83%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere0.83%
SoilEnvironmental → Terrestrial → Soil → Sand → Desert → Soil0.83%
RockEnvironmental → Terrestrial → Rock-Dwelling (Subaerial Biofilms) → Unclassified → Unclassified → Rock0.83%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere0.83%
Populus EndosphereHost-Associated → Plants → Roots → Bulk Soil → Unclassified → Populus Endosphere0.83%
Tabebuia Heterophylla RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Unclassified → Tabebuia Heterophylla Rhizosphere0.83%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere0.83%
SoilEnvironmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil0.41%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment0.41%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil0.41%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil0.41%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil0.41%
Sub-Biocrust SoilEnvironmental → Terrestrial → Soil → Unclassified → Desert → Sub-Biocrust Soil0.41%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere0.41%
SoilEnvironmental → Terrestrial → Agricultural Field → Unclassified → Unclassified → Soil0.41%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere0.41%
Quercus RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Quercus Rhizosphere0.41%
Tabebuia Heterophylla RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere0.41%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.41%
Arabidopsis Thaliana RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere0.41%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere0.41%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.41%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.41%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.41%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere0.41%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2228664022Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300000531Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNB_Illumina_AssembledHost-AssociatedOpen in IMG/M
3300001537Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A20-65 cm-11A)- 1 week illuminaEnvironmentalOpen in IMG/M
3300002547Polar desert microbial communities from Antarctic Dry Valleys - UQ889EnvironmentalOpen in IMG/M
3300002568Grasslands soil microbial communities from Hopland, California, USA - 2EnvironmentalOpen in IMG/M
3300003373Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1Host-AssociatedOpen in IMG/M
3300003993Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailC_D2EnvironmentalOpen in IMG/M
3300004081Grasslands soil microbial communities from Hopland, California, USA - 2 (version 2)EnvironmentalOpen in IMG/M
3300004156Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1EnvironmentalOpen in IMG/M
3300004463Combined assembly of Arabidopsis thaliana microbial communitiesHost-AssociatedOpen in IMG/M
3300005045Permafrost microbial communities from Fox Tunnel, Fairbanks, Alaska, USAEnvironmentalOpen in IMG/M
3300005332Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300005347Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaGHost-AssociatedOpen in IMG/M
3300005366Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaGHost-AssociatedOpen in IMG/M
3300005441Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaGEnvironmentalOpen in IMG/M
3300005457Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaGHost-AssociatedOpen in IMG/M
3300005543Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaGHost-AssociatedOpen in IMG/M
3300005578Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2Host-AssociatedOpen in IMG/M
3300005713Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2)EnvironmentalOpen in IMG/M
3300005718Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2Host-AssociatedOpen in IMG/M
3300005937Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1Host-AssociatedOpen in IMG/M
3300006038Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5Host-AssociatedOpen in IMG/M
3300006048Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3Host-AssociatedOpen in IMG/M
3300006049Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1Host-AssociatedOpen in IMG/M
3300006058Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1Host-AssociatedOpen in IMG/M
3300006844Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2Host-AssociatedOpen in IMG/M
3300006845Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5Host-AssociatedOpen in IMG/M
3300006846Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4Host-AssociatedOpen in IMG/M
3300006876Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS200EnvironmentalOpen in IMG/M
3300006894Agricultural soil microbial communities from Utah to study Nitrogen management - NC ControlEnvironmentalOpen in IMG/M
3300006903Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5Host-AssociatedOpen in IMG/M
3300007790Microbial communities of desert soil contaminated with blood from dead anthrax infected zebra in Etosha National Park, Namibia. Combined Assembly of 14 sequencing projectsEnvironmentalOpen in IMG/M
3300009090Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaGEnvironmentalOpen in IMG/M
3300009094Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009156Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009553Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaGHost-AssociatedOpen in IMG/M
3300009789Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot28EnvironmentalOpen in IMG/M
3300009840Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105AEnvironmentalOpen in IMG/M
3300010036Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot26EnvironmentalOpen in IMG/M
3300010037Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot25EnvironmentalOpen in IMG/M
3300010038Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot106EnvironmentalOpen in IMG/M
3300010039Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot56EnvironmentalOpen in IMG/M
3300010040Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot55EnvironmentalOpen in IMG/M
3300010041Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot104AEnvironmentalOpen in IMG/M
3300010042Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105BEnvironmentalOpen in IMG/M
3300010044Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot60EnvironmentalOpen in IMG/M
3300010045Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot61EnvironmentalOpen in IMG/M
3300010047Tropical forest soil microbial communities from Panama - MetaG Plot_30EnvironmentalOpen in IMG/M
3300010145Soil microbial communities from Hawaii, USA to study soil gas exchange rates - KP-HI-INT metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010166Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot27EnvironmentalOpen in IMG/M
3300010371Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1EnvironmentalOpen in IMG/M
3300010396Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2EnvironmentalOpen in IMG/M
3300010399Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3EnvironmentalOpen in IMG/M
3300012021Terrestrial microbial communites from a soil warming plot in Okalahoma, USA - T1EnvironmentalOpen in IMG/M
3300012022Terrestrial microbial communites from a soil warming plot in Okalahoma, USA - C6EnvironmentalOpen in IMG/M
3300012045Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ449 (21.06)EnvironmentalOpen in IMG/M
3300012092Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ445A (23.06)EnvironmentalOpen in IMG/M
3300012093Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ611 (21.06)EnvironmentalOpen in IMG/M
3300012185Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ353 (21.06)EnvironmentalOpen in IMG/M
3300012188Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ330 (21.06)EnvironmentalOpen in IMG/M
3300012198Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaGEnvironmentalOpen in IMG/M
3300012204Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaGEnvironmentalOpen in IMG/M
3300012678Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ288 (22.06)EnvironmentalOpen in IMG/M
3300012680Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ224A (23.06)EnvironmentalOpen in IMG/M
3300012896Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S118-311C-2EnvironmentalOpen in IMG/M
3300012897Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S074-202C-1EnvironmentalOpen in IMG/M
3300012905Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S013-104B-2EnvironmentalOpen in IMG/M
3300012907Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S044-104R-1EnvironmentalOpen in IMG/M
3300012911Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S088-202R-2EnvironmentalOpen in IMG/M
3300012939Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t1i015EnvironmentalOpen in IMG/M
3300012957Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MGEnvironmentalOpen in IMG/M
3300013012Gypsum rock endolithic microbial communities from the Atacama Desert, Chile - Cordon de LilaEnvironmentalOpen in IMG/M
3300013026Gypsum rock hypoendolithic microbial communities from the Atacama Desert, Chile - Cordon de LilaEnvironmentalOpen in IMG/M
3300013306Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaGHost-AssociatedOpen in IMG/M
3300013765Permafrost microbial communities from Nunavut, Canada - A30_80cm_6MEnvironmentalOpen in IMG/M
3300014263Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleC_D1EnvironmentalOpen in IMG/M
3300014271Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberrySE_CattailA_D2EnvironmentalOpen in IMG/M
3300014302Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNE_CattailA_D2EnvironmentalOpen in IMG/M
3300014488Bulk soil microbial communities from Mexico - San Felipe (SF) metaGEnvironmentalOpen in IMG/M
3300015373Combined assembly of cpr5 rhizosphereHost-AssociatedOpen in IMG/M
3300017787Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ497 (22.06) (version 2)EnvironmentalOpen in IMG/M
3300017789Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ322 (21.06)EnvironmentalOpen in IMG/M
3300018028Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_coexEnvironmentalOpen in IMG/M
3300018061Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_b1EnvironmentalOpen in IMG/M
3300018073Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_5_b1EnvironmentalOpen in IMG/M
3300018422Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 TEnvironmentalOpen in IMG/M
3300018429Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 TEnvironmentalOpen in IMG/M
3300018432Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 550 TEnvironmentalOpen in IMG/M
3300018465Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 ISEnvironmentalOpen in IMG/M
3300018466Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 TEnvironmentalOpen in IMG/M
3300018469Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 TEnvironmentalOpen in IMG/M
3300018476Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 TEnvironmentalOpen in IMG/M
3300019356Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S073-202C-2 (version 2)EnvironmentalOpen in IMG/M
3300019377Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 112 TEnvironmentalOpen in IMG/M
3300019767Populus adjacent soil microbial communities from riparian zone of Oak Creek, Arizona, USA - 239 TEnvironmentalOpen in IMG/M
3300019865Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1s1EnvironmentalOpen in IMG/M
3300019884Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L2s2EnvironmentalOpen in IMG/M
3300021184Soil microbial communities from Anza Borrego desert, Southern California, United States - S1+v_20EnvironmentalOpen in IMG/M
3300021339Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3c1EnvironmentalOpen in IMG/M
3300022756Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1EnvironmentalOpen in IMG/M
3300025791Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleB_D2 (SPAdes)EnvironmentalOpen in IMG/M
3300025919Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025934Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025937Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025944Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025945Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025949Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026075Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026118Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300027638Polar desert microbial communities from Antarctic Dry Valleys - UQ889 (SPAdes)EnvironmentalOpen in IMG/M
3300027691Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS100 (SPAdes)EnvironmentalOpen in IMG/M
3300027873Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 (SPAdes)Host-AssociatedOpen in IMG/M
3300027907Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes)Host-AssociatedOpen in IMG/M
3300027909Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes)Host-AssociatedOpen in IMG/M
3300028589Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Glucose_Day1EnvironmentalOpen in IMG/M
3300028704Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_379EnvironmentalOpen in IMG/M
3300028705Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_115EnvironmentalOpen in IMG/M
3300028707Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_148EnvironmentalOpen in IMG/M
3300028713Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_184EnvironmentalOpen in IMG/M
3300028714Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_196EnvironmentalOpen in IMG/M
3300028721Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_355EnvironmentalOpen in IMG/M
3300028744Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_367EnvironmentalOpen in IMG/M
3300028755Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_356EnvironmentalOpen in IMG/M
3300028814Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_183EnvironmentalOpen in IMG/M
3300028876Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_140EnvironmentalOpen in IMG/M
3300028878Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_117EnvironmentalOpen in IMG/M
3300028880Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_181EnvironmentalOpen in IMG/M
3300028889Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day2EnvironmentalOpen in IMG/M
3300030006Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT152D67EnvironmentalOpen in IMG/M
3300030336Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day1EnvironmentalOpen in IMG/M
3300030511Bulk soil microbial communities from Mexico - Amatitan (Am) metaG (v2)EnvironmentalOpen in IMG/M
3300031152Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 15_SEnvironmentalOpen in IMG/M
3300031226Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 10_SEnvironmentalOpen in IMG/M
3300031229Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT155D38EnvironmentalOpen in IMG/M
3300031548Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3Host-AssociatedOpen in IMG/M
3300031731Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1Host-AssociatedOpen in IMG/M
3300031901Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2Host-AssociatedOpen in IMG/M
3300031938Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1EnvironmentalOpen in IMG/M
3300031995Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2Host-AssociatedOpen in IMG/M
3300032005Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1Host-AssociatedOpen in IMG/M
3300032075Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D3EnvironmentalOpen in IMG/M
3300032080Soil microbial communities from Southern Great Plains, Lamont, Oklahoma, United States - SGP_1_2016EnvironmentalOpen in IMG/M
3300032126Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2Host-AssociatedOpen in IMG/M
3300034251Sub-biocrust soil microbial communities from Mojave Desert, California, United States - 43SMSEnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
INPgaii200_057666922228664022SoilMWKRLRRRTLAPSRPAVFPDQIGLLAITVIAMAAGIYVVVRFLL
CNBas_101091213300000531Quercus RhizosphereMWKRLRRRSFAPGRPAVYMEQIGLLVVTLVAMAVGIYVVARFLL*
A2065W1_1005753023300001537PermafrostMWKRLRRRTMAPSRPLLYPDQIGLLVFTLIAIGVGAWFVVRLAFG*
JGI24973J35851_101732823300002547Polar DesertVWKRLRRRSFAPGRPAVYDDQVGLVVFVVVALGAGIYFAVKLAI*
C688J35102_11861085323300002568SoilMWKRLRRRTFAPSRPAVYPEQIGLLIFTVVALLTGIYVVARFLL*
C688J35102_11899842723300002568SoilMWKRLRRRTFAPSRPAVYPDQIGLLVFTIAALVVGTYVVVRFLL*
C688J35102_12050998723300002568SoilMWKRLRRRTMAPSRPALYPDQVGLLVFSLLAVAGGIYAVVRLLLA*
C688J35102_12083872643300002568SoilMWKRLRRRTMAPSRPALYPEQVGLLVFSLLAVGGGIYVAVRLAFG*
JGI25407J50210_1000028893300003373Tabebuia Heterophylla RhizosphereMWRRLRRRTMAPSTPAVYPDQLGLVVFTVVALAVGIYAAARWLL*
JGI25407J50210_1003675923300003373Tabebuia Heterophylla RhizosphereMWKRLRRRTLAPSRPALYPDQAGLVFFIVLASGIGIYAVVRFLL*
Ga0055468_1021141123300003993Natural And Restored WetlandsMWKRFRRRTFAPSRPALYADQIGLALFSVAALVIGTYVVARFLL*
Ga0063454_10194445423300004081SoilMWKRLRRRTFAPSRPALYGDQLGLLLVCLLVIGLGMYVVVRVLFG*
Ga0063454_10194834413300004081SoilMWKRLRRRTFAPSRPAVYPEQVGLLLITLLVIAGGIWVFVKVL*
Ga0062589_10167115423300004156SoilMWKRLRRRTFAPSRPAVYPDQIGLLIFTVAALAAGIYVVARFLL*
Ga0063356_10321404823300004463Arabidopsis Thaliana RhizosphereMWKRLRRRSLAPGRPALYPDQIGLAFFSVVALAGGIYVVVRFLL*
Ga0071328_11987633300005045PermafrostMWRRFRRRSMAPSRPALYPDQIGLLIFTLAALASGIWAVVHYIL*
Ga0071328_15720313300005045PermafrostMPWKRLRRRTLAPSRPALYPDQIGLFVFSLAAIGAGLYAAFRFLL*
Ga0066388_10533933823300005332Tropical Forest SoilMWKRLRRRTFAPSRPALFPDQIGLLVITLVAMGAGIYVVARFLL*
Ga0070668_10147869513300005347Switchgrass RhizosphereMPWKNLRRRTMAPSRPALYPDQVGLFVLTVLALGAGIYAALRFLL*
Ga0070659_10169903623300005366Corn RhizosphereKRLRRRTFAPSRPAVYPDQIGLLMFTVVAVAGGIYVVARFLL*
Ga0070700_10083812823300005441Corn, Switchgrass And Miscanthus RhizosphereMWKRLRRRTFAPSRPAVYPDQIGLLIVTVLALLAGTYVVVRFLL*
Ga0070662_10165356213300005457Corn RhizosphereHGHSFPGMWRRLRRRTFAPSRPAVFPDQIGLLVITLAAMGVGIYVVARFLL*
Ga0070672_10149000223300005543Miscanthus RhizosphereMWKRLRRRTFAPSRPALFPDQIGLLVITLLAMGAGIYVVARFLL*
Ga0068854_10125024423300005578Corn RhizosphereMWKRLRRRTFAPSRPAVYPDQIGLLIVTALALLAGTYVVLRFLL*
Ga0066905_10107916723300005713Tropical Forest SoilMGSLHPMWKRLRRRTFAPSRPAVFPDQVGLLAITVVAMAIGIYVVVRFLL*
Ga0068866_1053484723300005718Miscanthus RhizosphereMWKRLRRRTFAPSRPAVFADQIGLLAITVVAMAAGIYVVARFLL*
Ga0081455_1005658453300005937Tabebuia Heterophylla RhizosphereMPWKRLRRRSMAPSRPAVYPDQIGLVLFTVIAIAVGIWAVFRYLL*
Ga0075365_1048065433300006038Populus EndosphereMPWKRLRRRTMAPSRPAVYPDQIGLLVFTLAALGAGIYAAFRYLL*
Ga0075363_10079673223300006048Populus EndosphereMAPSRPAVYPDQIGLLVFTLAALGAGIYAAFRYLL*
Ga0075417_1021463113300006049Populus RhizosphereMWKRLRRRSLAPGRPAVYPDQIGLLVFTLAALAGGIYVVVRFLL*
Ga0075417_1051416823300006049Populus RhizosphereKRLRRRSMAPSRPALYPDQIGLFVLTMAALGAGIYAVVRYLL*
Ga0075417_1051433613300006049Populus RhizosphereMWKRLRRRTFAPSRPALFPDQIGLLAITLVAMGVGIYVAARFLL*
Ga0075432_1001310123300006058Populus RhizosphereMWKRLRRRTFAPSRPALYPDQIGLLIFTVAALAGGIYVVARYLL*
Ga0075428_10004075553300006844Populus RhizosphereMAPSRPALYPDQIGLFVFTVAALGAGIYAALRYLL*
Ga0075428_10077294723300006844Populus RhizosphereMWKRLRRRTFAPSRPAVYPDQVGLLFFTAIALIVGIYVVARFLL*
Ga0075428_10253603213300006844Populus RhizosphereLRRRTMAPSRPAVYPDQIGLLVFTLAALGAGIYAAFRYLL*
Ga0075421_10204189823300006845Populus RhizosphereMWKRLRRRTFAPSRPAVYPDQIGLLIFTVIALAAGTYVVFRFLL*
Ga0075430_10022264223300006846Populus RhizosphereMWKRLRRRTFAPSRPAVYPDQIGLLFFTVIALIAGIYVVVRFLL*
Ga0079217_1118834823300006876Agricultural SoilMWRRFRRRTLAPGRPALYPDQVGLALFSLLAIVAGIYVVVRFLL*
Ga0079215_1017630723300006894Agricultural SoilRRLRRRTFAPSRPAVFPDQIGLLVFTLVAMAVGIYVVARFLL*
Ga0075426_1112495013300006903Populus RhizosphereTFAPSRPALYPDQIGLLIFTVAALAGGIYVVARYLL*
Ga0105679_1088343023300007790SoilMAPSRPALFPDQYGLFALTLLAIGAGIYAAFRFLL*
Ga0099827_1117629223300009090Vadose Zone SoilMAPSRPALYPDQVGLLIFTLAALGGGIWAVAHFVF*
Ga0111539_1054459223300009094Populus RhizosphereMWKRLRRRTFAPSRPALFPDQIGLLAITLVAMAAGIYVVARFLL*
Ga0111539_1196947313300009094Populus RhizosphereMWKRLRRRTFAPSRPAVYPDQIGLLMFTVVAVAGGIYVVARFLL*
Ga0111538_1311544423300009156Populus RhizosphereMWKRLRRRTFAPSRPAVFADQIGLLVITVIAMAAGIYVVARFLL*
Ga0105249_1301304523300009553Switchgrass RhizosphereLRRRTMSPGRPLLYPDQIGLALFTLIALAVGIFAVVRYLL*
Ga0126307_10000058513300009789Serpentine SoilMWKRLRRPTFAPSRPALHQDQIGLLVFVVLALGAGIYFALRFAL*
Ga0126307_10000295403300009789Serpentine SoilMWKRLRRRSMAPSRPALYFDQIGLAVFTVVALAVGTYLAFRYLL*
Ga0126307_1007105243300009789Serpentine SoilMAPSRPVLYPDQIGLFVFTVAAIGGGIYAALRYLL*
Ga0126307_1007396423300009789Serpentine SoilMWKRLRRGSLAPGRPVIYTEQVGLLVVTVVALAVGIYVVARFLL*
Ga0126307_1007450723300009789Serpentine SoilMWKRLRRRTFAPSRPAVYPDQIGLLLLTVLALGAGTYVVFRFLL*
Ga0126307_1011300823300009789Serpentine SoilMSWKRLRRRSMAPSRPALYPDQIGLFVFTVAALGAGIYAAFRFLL*
Ga0126307_1028113533300009789Serpentine SoilLAPGRPALYPDQIGLAVVTVAALAGGIYVVARFLL*
Ga0126307_1034207613300009789Serpentine SoilMFWQRLRRRTMTPSRPALHPDQVGLLVFTVLALGVGIYAAVRLLVA*
Ga0126307_1100420623300009789Serpentine SoilMWKRLRRRTFTPSRPAVYPDQIGLLFFTLIALAVGIGVVLRFLL*
Ga0126307_1109226913300009789Serpentine SoilMAPSRPVLYPDQIGLFVFTLAALGGGIYAALRYLL*
Ga0126313_10002181123300009840Serpentine SoilMWKRLRRKTIAPGRPALYADQVGLLGFSLIAVAGGIYIAVRLAFG*
Ga0126313_1006857923300009840Serpentine SoilMWKRLRRRTFAPSRPALHQDQIGLLVFVVLALGAGIYFALRFAL*
Ga0126313_1014331423300009840Serpentine SoilMWKRLRRRTFAPSRPAVYPDQIGLLVFTVIALGTGTYAVVRFLL*
Ga0126313_1023217143300009840Serpentine SoilMWKRLRRRSFAPSRPAVFADQIGLLAVTLVAMATGIYVVARFLL*
Ga0126313_1029467723300009840Serpentine SoilMWKRLRRRTFAPDRPAVYPDQVGLVVFTIAALAGGIYVVVRFLL*
Ga0126313_1049957023300009840Serpentine SoilMAPSRPALHPDQIGLFVLTVAAIGAGIYAALRFLM*
Ga0126313_1057812613300009840Serpentine SoilMWKRLRRRTFAPSRPAVYADQIGLLVVTLVAMAAGTYVVVRFLL*
Ga0126313_1065951133300009840Serpentine SoilMWKRLRRRSLEPGRPALYRDQIGLAVVTLAALASGIYVVARFLL*
Ga0126313_1090469123300009840Serpentine SoilMWKRLRRRTMAPSRPALYPDQVGLLVFTLLALGVGIFVVVRLVLG*
Ga0126313_1144804313300009840Serpentine SoilMAPSRPALYPDQVGLLVFTLLALGIGTYAVVRFLL*
Ga0126313_1149123523300009840Serpentine SoilMWKRMRRRTFAPSRPAVFPDQIGLLAVTLVAMGVGIYVVARFLL*
Ga0126305_1041025723300010036Serpentine SoilMWKRLRRKTMAPGRPALYADQVGLLGFSLIAVAGGIYIAVRLAFG*
Ga0126304_1032543023300010037Serpentine SoilMWKRLRRRTFAPGRPAVYPDQIGLLVFTLVALAAGIYVVVRFLL*
Ga0126315_1001037763300010038Serpentine SoilMWKRLRRRTFAPSRPAVYADQIGLLVVTLVAMAAGIYVVVRFLL*
Ga0126309_1001809623300010039Serpentine SoilMWKRLRRRTFAPSRPAVYPEQIGLLFFTLIALLAGIYVVARFLL*
Ga0126309_1001874823300010039Serpentine SoilMWKRLRRRSFAPGRPAVYMEQVGLLVVTLVALGVGIYVVARFLL*
Ga0126309_1003881423300010039Serpentine SoilMWKRLRRRTFAPSRPAVFADQIGLLAITLVATAAGIYVVARFLL*
Ga0126309_1008763723300010039Serpentine SoilMWKRYRRRTFAPSRPALYPDQIGLLLFTLVALAAGIYVVARFLL*
Ga0126309_1010030733300010039Serpentine SoilVTAIWKRLRRKTMAPSRPALYPDQVGLAIFSLLAIAGGIYAVVRLFIA*
Ga0126309_1016971923300010039Serpentine SoilMWKRLRRRSLAPGRPAVYPDQIGLLVFTVLALAAGIYWVARFLL*
Ga0126309_1024955323300010039Serpentine SoilMWKRFRRRTMAPGRPVLYPDQVGLLVFTLLAIGGGIYFVARVVFG*
Ga0126309_1043567923300010039Serpentine SoilMSWKRLRRRSMAPSRPALYPDQIGLFVFTLAALGGGIYAALRFLL*
Ga0126309_1079143023300010039Serpentine SoilMWKRLRRRSLAPGRPALYPDQIGLAVFTLAALAAGIYMVARFLL*
Ga0126308_1004969023300010040Serpentine SoilMWKRLRRRSLAPGRPAVYSDQVGLLVVTLVALAVGIYMVARFLL*
Ga0126308_1015954133300010040Serpentine SoilMPWKRLRRRSMAPSRPALYPDQIGLFIFTLAALGAGIYAALRYLL*
Ga0126308_1038726123300010040Serpentine SoilMWRKLRRRTMAPSRPALHPDQIGLLIFTLLAVGGGVYLVVRVAFG*
Ga0126308_1043194713300010040Serpentine SoilDLMWKRLRRRTMAPSRPALYPDQVGLLVFSLLAIAGGLYVVVRLAFG*
Ga0126308_1121463423300010040Serpentine SoilRTFAPSRPAVYPDQIGLLVITVVALGAGTYVVFRFLL*
Ga0126312_1000060323300010041Serpentine SoilMWKRLRRRTMVPSRPAVYPEQVGLLVFSLLAVGGGIYVVVRLAFG*
Ga0126312_1000209333300010041Serpentine SoilMWKRLRRPTFAPSRPALHQDQIGLLVFVVLALGAGIYFALRFAF*
Ga0126312_1033737033300010041Serpentine SoilMRRRTFAPSRPAVFPDQIGLLAVTLVAMGVGIYVVARFLL*
Ga0126314_1056177923300010042Serpentine SoilMAPSRPLLYPDQIGLFAITLIALGAGIYAALRYLL*
Ga0126314_1101639923300010042Serpentine SoilMWKRLRWRSLAPGRPAVYMEQIGLLAVTLVALAIGIYVVARFLL*
Ga0126310_1002689453300010044Serpentine SoilMWKRLRRRTLAPSRPAVYPDQIGLLVFTVIALLAGIYVVARFLL*
Ga0126310_1028584323300010044Serpentine SoilMAPSRPLLYPDQIGLALFTLIALGAGIYAALRYLL*
Ga0126310_1035535833300010044Serpentine SoilMWKRLRRRTFAPSRPAVFADQIGLLAVTLVAIAAGIYVVARFLL*
Ga0126310_1108300823300010044Serpentine SoilMWKRFRRRTFAPSRPALYPDQAGLLVITVVAMAVGIYVVARFLV*
Ga0126311_1026662323300010045Serpentine SoilMWKRLRRGSLAPGRPVIYTEQVGLLVVTVVALAVGIYVMARFLL*
Ga0126311_1033821433300010045Serpentine SoilMPKKRVPRLLRRTMAPSRPLLYPDQIGLFAITVIALGAGIYAAVRYLL*
Ga0126311_1130561813300010045Serpentine SoilMWKRLRRRTFTPSRPAVYPDQIGLLLLTVLALGAGTYVVFRFLL*
Ga0126382_1024804423300010047Tropical Forest SoilRRSLAPSRPAVYPDQVGLLIFSVAAIAGGIYVVFRFLL*
Ga0126321_127572423300010145SoilTFAPSRPAVFSDQIGLLIITVGAMAGGIYVVARFLL*
Ga0126306_1001059253300010166Serpentine SoilMWKRLRRRTFAPSRPAVYADQIGLLAVTLVAMAAGTYVVVRFLL*
Ga0126306_1004227553300010166Serpentine SoilMWKRLRRRTFAPSRPAVYPDQVGLLLLTVLALGAGTYVVFRFLL*
Ga0126306_1010746243300010166Serpentine SoilMWKRLRRRTFAPGRPAVYPDQAGLVVFTIAALAGGIYVVVRFLL*
Ga0134125_1277491723300010371Terrestrial SoilRRRTFAPSRPAVFPDQIGLLVITVAAMAVGIYVVARFLL*
Ga0134126_1133233813300010396Terrestrial SoilMWKRLRRRTFAPSRPAVYPDQIGLLIVTVLALLAGTYVV
Ga0134127_1114861823300010399Terrestrial SoilMWKRLRRRTFAPSRPAVYPDQIGLLIFTGVAVAGGIYVVARFLL*
Ga0134127_1147796523300010399Terrestrial SoilMWKRLRRRTFAPSRPAVFADQIGLLVITLIAMAAGIYVVARFLL*
Ga0120192_1006118923300012021TerrestrialMWKRLRRRSLAPGRPALYPDQIGLAVITLAALAGGIYVVARFLL*
Ga0120191_1004979523300012022TerrestrialMWRRLRRRTFAPSRPAVYPDQIGLVAITLVAMGIGTYVVLRFLL*
Ga0136623_1000453133300012045Polar Desert SandVEAAARRSFAPGRPAVYDDQVGLVVFVVVALGAGIYFAVKLAI*
Ga0136621_127532223300012092Polar Desert SandMAPSRPLLYPDQIGLALFSLIAIGGGIWAVFEFAL*
Ga0136632_1001218233300012093Polar Desert SandVWRRLRRRSFAPGRPAVYDDQVGLVVFVVAALGAGIYFALKLAI*
Ga0136632_1002231343300012093Polar Desert SandMWKRLRRRSFAPGRPALYDDQIGLMVFVVAALGVGIYFALKIAI*
Ga0136619_1011129733300012185Polar Desert SandFAPGRPALYDDQIGLMVFVVAAPGVGIYFALKIAI*
Ga0136618_1014396623300012188Polar Desert SandMWKRLRRRSFAPGRPALYDDQIGLMVFVVTALGVGIYFALKIAI*
Ga0137364_1013082523300012198Vadose Zone SoilMWKRLRRRTMAPGRPALYPDQVGLLVFSVLAVAGGIYVVVRLAFG*
Ga0137364_1112267823300012198Vadose Zone SoilMWKRLRRRTFAPSRPALYGDQLGLVLICVLVIAFGIYVVVRVVIG*
Ga0137374_1052309323300012204Vadose Zone SoilMAPSRPALYPDQIGLFVITLIAIGAGIYAALRYLL*
Ga0136615_1011518443300012678Polar Desert SandVWKRLRRRSFAPGRPAVYDDQVGLVVFVVVALGAGIYFALQLAVRLWL
Ga0136612_1003370543300012680Polar Desert SandVWKRLRRRSFAPGRPAVYDDQVGLVVFVVVALGAGIYFALKLAI*
Ga0136612_1004883943300012680Polar Desert SandMWKRLRRRTMTPSRPALYPDQLGLLLFSLAAIGGGLYAVWRVFTG*
Ga0136612_1025152623300012680Polar Desert SandMAPSRPALYPDQAGLLLVCLAAIAGGLYAAARVFFG*
Ga0157303_1018261823300012896SoilMWKRLRRRTFAPSRPAVYPDQIGLLIFTVVAVAGGIYVVARFLL*
Ga0157285_1017181323300012897SoilMWKRLRRRTFAPSRPAVYPDQIGLLIFTVLALAVGIYVVARFLL*
Ga0157296_1004925623300012905SoilMWKRLRRRTFAPSRPAVFADQIGLLAITVIAMAAGIYVVARFLL*
Ga0157283_1023144013300012907SoilRRRTMSPNRPLLYPDQIGLALFTLIALAVGIFAVVRYLL*
Ga0157301_1011823623300012911SoilMWKRLRRRTLAPSRPAVFADQIGLLVITVIAMAAGIYVVARFLL*
Ga0162650_10007292423300012939SoilMWKRLRRRSLAPGRPALYPDQIGLAFFTVAALVGGIYVVARFLL*
Ga0164303_1120695223300012957SoilMWKRLRRRTFAPSRPALYPEQVGLLIITLLVIAGGIWAFLKVL*
Ga0169965_103445023300013012RockWKRFRRRTFAPSRPALYSDQIGLAVFVVAAFAAGLFFAVRVFS*
Ga0170681_100612443300013026RockMWKRFRRRTFAPSRPALYSDQIGLAVFVVAAFAAGLFFAVRVFS*
Ga0163162_1251791223300013306Switchgrass RhizosphereKCPAMLWKRLRRRTMAPSRPALYPDQIGLFVITLIALGAGIYAAFRYLL*
Ga0120172_101926833300013765PermafrostMWKRLRRRTMAPSRPLFYPDQIGLLVFTLIAIGVGAWFVVRLAFG*
Ga0075324_104819723300014263Natural And Restored WetlandsMAPSRPALYPDQVGLLVFTLAALGAGIYAAFRYLL*
Ga0075326_107496313300014271Natural And Restored WetlandsMAPGRPALYPDQIGLFVFTVAALGGGIYAALRYLL*
Ga0075310_108626113300014302Natural And Restored WetlandsKRLRRRTMAPSRPALYPDQIGLFVFTVAALGGGIYAALRYLL*
Ga0182001_1027519523300014488SoilMWKRLRRRTMAPSRPALYPDEIGLLVITLAAVGGGIYFAVRTFFG*
Ga0132257_10285507923300015373Arabidopsis RhizosphereMAPSRPVLYPDQVGLFVLTVLAVGAGIYAALRFLL*
Ga0183260_1010185743300017787Polar Desert SandVWKRLRRRSFAPGRPAVYDDQVGLVVFVVVALGAGVYFALKLAI
Ga0183260_1074966723300017787Polar Desert SandMAPSRPILYPDQIGLAFFSLLAVLGGIYAIVKLVS
Ga0136617_1006802133300017789Polar Desert SandVWKRLRRRSFAPGRPAVYDDQVGLVVFVVVALGAGIYFALKLAI
Ga0136617_1021052023300017789Polar Desert SandMWKRLRRRSFAPGRPALYDDQIGLMVFVVTALGVGIYFALKIAI
Ga0136617_1055998233300017789Polar Desert SandMWRRLRRRTMAPHRPILYRDQIGLAVITVVVFAVGIYVVARLVIG
Ga0136617_1060486123300017789Polar Desert SandMWKRLRRRSFAPGRPALYDDQIGLMVFVVAALGVGIYFALKIAI
Ga0184608_1041267813300018028Groundwater SedimentRRSFAPGRPAVYMEQVGLLVITLVALAVGIYVVARFLL
Ga0184619_1016478513300018061Groundwater SedimentMAPSRPALYPDQVGLLIFTLAALGGGIWAVAHFVF
Ga0184619_1039860123300018061Groundwater SedimentRRRSMAPSRPALYPDQIGLFVITLIALGAGIYAALRYLL
Ga0184619_1050695013300018061Groundwater SedimentMWKRLRRRSLAPGRPALYPDQVGLAVFTLAALVGGIYVVARFLL
Ga0184624_1012146033300018073Groundwater SedimentMPWKRLRRRTMAPSRPALYPDQIGLFVLTLAAIGGGIYAALRYLL
Ga0190265_10003263103300018422SoilMWKRLRRRTFAPSRPAVYMEQIGLLVITLFALAVGIYVVARFLL
Ga0190265_1003475663300018422SoilMWKRLRRRTMAPGRPALYPDQVGLALFSLVAVAGGIYAVARFLL
Ga0190265_1040298123300018422SoilMWKRLRRRTFAPSRPALYPDQVGLAIFVLLALAAGIYVVARFLL
Ga0190265_1114594333300018422SoilMWRKLRRRTMAPSRPAVYPDQIGLVVFTVLALAVGIYAAVRWLL
Ga0190265_1154762413300018422SoilKRLRRRSFAPGRPAVYMEQVGLLVVTLVALAGGIYVVARFLL
Ga0190265_1313659823300018422SoilMWKRLRRRPFAPGRPAVHEDQIGLLLFVIVGLGVGIYFALRFAT
Ga0190272_1032287343300018429SoilMAPSRPALYPDQVGLLAITLVALGAGIYVVFRFLL
Ga0190272_1076118423300018429SoilMWKRFRRRTMAPGRPALYPDQVGLALFSLVAVAGGIYAVARFLL
Ga0190272_1120644223300018429SoilMWKRLRRKTFAPGRPAVYPDQVGLVIFTAAALIAGTYVVARFLL
Ga0190275_1053379733300018432SoilMWKRLRRRTFGPSRPALYDDQYGLLFFVLLALGVGIYFAFKFAL
Ga0190275_1089114423300018432SoilMWKRLRRRTFAPGRPAVHEDQIGLLLFVIVALGVGIYCALRFAT
Ga0190275_1114652823300018432SoilMWKRFRRRTFAPSRPALYPDQIGFAVFTVAALAAGIYVVARFLL
Ga0190275_1145249423300018432SoilMWKRLRRRTFAPSRPALFPDQIGLVLIVLLALGVGIFFAVRVVV
Ga0190275_1161211723300018432SoilMWKRLRRLQRRTMAPSRPVVYPDQIGLVFFTLVVFAVGAYVIVRLVIG
Ga0190275_1224241923300018432SoilMWKRVRRRSFAPGRPAVYVEQVGLLAVTLVALAVGIYVVARFLL
Ga0190269_1048302223300018465SoilMLWKRLRRRSLAPGRPALYPDQIGLAVFTVAALVGGIYVVVRFLL
Ga0190269_1080086623300018465SoilRMWKRLRRRTFAPSRLAVYPDQVGLLFFTVIALIVGIYVVVRFLL
Ga0190268_1034062823300018466SoilMPWKRLRRRTMAPSRPVLYPDQIGLLVFTLAAIGGGIYAALRYLL
Ga0190268_1164895423300018466SoilMLWKRLRRRSLAPGRPALYPDQIGLAFFTVVALVGGIYVVVRFLL
Ga0190268_1166202423300018466SoilMWKRLRRRSLAPGRPAVYMEQVGLLVVTLAALAGGIYVVVRFLL
Ga0190270_1006500643300018469SoilMPWKRLRRRTMAPSRPALYPDQIGLLVFTVAAIGGGIYAALRYLL
Ga0190270_1092191413300018469SoilMWKRLRRRTFAPSRPAVREDQIGLVLFIVVALGVGFYFALRFAI
Ga0190270_1120095223300018469SoilMWRKLRRRTMAPSRPAVYPDQIGLVVFTVLALGVGIYAAVRWLL
Ga0190270_1156216723300018469SoilMWKRLRRRTFAPGRPALYEDQIGLAVFVVVAFAVGIYFALRFAI
Ga0190270_1342552823300018469SoilMWKRLRRRSLAPGRPALYPDQIGLAFFTVAALVGGIYVVARFLL
Ga0190274_1038320723300018476SoilMAPSRPALYPDQIGLLVFTVAAIGGGIYAALRYLL
Ga0190274_1264604613300018476SoilLRRRTLAPGRPAVYPDQAGLLVITLVALAVGIYVVVRFLL
Ga0173481_1033208123300019356SoilMWKRLRRRTFAPGRPAVFPDQIGLLVITVVAMAAGIYVVARFLL
Ga0173481_1056486913300019356SoilMWKRLRRRTFAPSRPAVYPDQIGLLMFTVVAVAGGIYVVARFLL
Ga0190264_1110754823300019377SoilMWKRLRRRTFAPGRPAVYPDQAGLLIFTIAALAAGIFVVVRFLL
Ga0190264_1122707823300019377SoilMWKRLRRRTFAPSRPALYPDQVGLVTFTVLALAVGIYVVARFLL
Ga0190267_1149579523300019767SoilMWKRLRRRTFAPSRPAVYPDQVGLLFFILIAMAVGIYVVVRFLL
Ga0193748_100126413300019865SoilMWKRLRRRTFAPSRPALYPDQVGLLIFTVVALAVGIYVVARFLL
Ga0193741_104782623300019884SoilMLWKRLRRRSLAPGRPALYPDQIGLAFFTVVALAGGIYVVVRFLL
Ga0196959_1011080123300021184SoilTFAPSRPALYPDQIGLAIFTVLALAAGIYVVLRFLL
Ga0193706_100437273300021339SoilMWKRLRRRTFAPRRPAVYMEQVGLLVVTLVALAVGIYVVVRFLL
Ga0222622_1072220313300022756Groundwater SedimentMWKRLRRRTFAPGRPAVYPDQIGVLVISVVAMAAGIYV
Ga0210115_101903523300025791Natural And Restored WetlandsMAPSRPALYPDQIGLFVFTVAALGGGIYAALRYLL
Ga0207657_1120738223300025919Corn RhizosphereRRTFAPSRPAVFPDQIGLLVITLVAMAAGIYVVARFLL
Ga0207686_1045046123300025934Miscanthus RhizosphereMWKRLRRRTFAPSRPAVYPDQIGLLIVTVLALLAGTYVVLRFLL
Ga0207669_1116675523300025937Miscanthus RhizosphereVLPMFDRLRRRTMSPGRPLLYPDQIGLALFTLIALAVGIFAVVRYLL
Ga0207661_1094805523300025944Corn RhizosphereMWKRLRRRTFAPSRPAVYPDQIGLLIFTGVAVAGGIYVVARFLL
Ga0207679_1157921123300025945Corn RhizosphereMWKRLRRRTFAPSRPALFPDQIGLLVITLLAMGAGIYVVARFLL
Ga0207667_1210906723300025949Corn RhizosphereRRRTFAPSRPAVFPDQIGLLVITLGAMAAGIYVVARFLL
Ga0207708_1080753323300026075Corn, Switchgrass And Miscanthus RhizosphereMWKRLRRRTFAPSRPAVYPDQIGLLIVTVLALLAGTYVVVRFLL
Ga0207675_10157395513300026118Switchgrass RhizosphereMAPSRPVLYPDQVGLFVLTVLALGAGIYAALRFLL
Ga0208612_100166253300027638Polar DesertVWKRLRRRSFAPGRPAVYDDQVGLVVFVVVALGAGIYFAVKLAI
Ga0209485_102268823300027691Agricultural SoilRRTFAPSRPAVFPDQIGLLVFTLVAMAVGIYVVARFLL
Ga0209814_1023859413300027873Populus RhizosphereMWKRLRRRTFAPSRPAVYPDQIGLLFFTVIALIAGIYVVVRFLL
Ga0207428_1048126023300027907Populus RhizosphereMWKRLRRRTFAPSRPALYPDQIGLLIFTVAALAGGIYVVARYLL
Ga0209382_1008628023300027909Populus RhizosphereMWKRLRRRSLAPGRPAVYPDQIGLLVFTLAALAGGIYVVVRFLL
Ga0209382_1043586123300027909Populus RhizosphereMAPSRPALYPDQIGLFVFTVAALGAGIYAALRYLL
Ga0209382_1165531623300027909Populus RhizosphereMWKRLRRRTFAPSRPAVYPDQVGLLFFTAIALIVGIYVVARFLL
Ga0247818_1025492743300028589SoilMPWKNLRRRTMAPSRPALYPDQVGLFVLTVLALGAGIYAALRFLL
Ga0307321_106249813300028704SoilMWKRLRRRTFAPGRPAVYPDQIGLLVISVVAMAAGIYVVARF
Ga0307276_1000422343300028705SoilMWNRLRRRTFAPSRPAVYPDQIGLLIFTVVALVAGIYVVARFLL
Ga0307276_1005456423300028705SoilMAPSRPLLYPDQIGLALFTLIALGAGIYAALRYLL
Ga0307276_1010659423300028705SoilSPVQSGAMWKRFRRRTMAPSRPALYPDQIGLLVFTLLAIGGGVYFIVRVVFG
Ga0307291_117153523300028707SoilMLWKRLRRRTMAPSRPALYPDQIGLFVITLIALGAGIYAAFRYLL
Ga0307303_1008501623300028713SoilMWKRLRRRTFAPSRPAVYPDQIGLLIFTVVALLAGIYVVARFLL
Ga0307309_1016541213300028714SoilMWKRLRRRTFAPSRPALYPDQVGLLIFTVVALAVGIYVVARFL
Ga0307315_1003499523300028721SoilMWKRLRRRTFAPSRPALFPDQIGLLAITLVAMAAGIYVVARFLL
Ga0307318_1021870823300028744SoilMWKRLRRRTFAPSRPALYEDQIGLLVIVVVALGVGIWFALRAFL
Ga0307316_1018276033300028755SoilMWKRLRRRTFAPSRPAVYPDQVGLLIFTLIALLAGIYVVVRFLL
Ga0307302_1043358123300028814SoilRRRTMAPSRPALYPDQIGLFVLTVLALGAGIYAALRFLL
Ga0307286_1021402723300028876SoilMAPSRPVLYPDQIGLFVLTVAALAGGIYAAVRYLL
Ga0307278_1039429623300028878SoilMWKRLRRRTFAPSRPALYPDQIGLLVVSVVAMAAGIYVVARFLL
Ga0307300_1006556733300028880SoilMWKRLRRRTMAPSRPALYPDQVGLLIFTLLAIGGGVYFLVRVVFG
Ga0247827_1004580113300028889SoilRTFAPSRPALYPDQIGLLIFTVAALAGGIYVVARYLL
Ga0299907_1002668123300030006SoilMWRKLRRRTMAPSRPAVYPDQIGLVVFTVLALSVGIYAAVRWLL
Ga0299907_1135482623300030006SoilMWKRLRRRSMSPSRPAIYPDQVGLLLFTLLAIGVGVYFAV
Ga0247826_1015508713300030336SoilKRLRRRTFAPSRPALYPDQIGLLIFTVAALAGGIYVVARYLL
Ga0247826_1018643823300030336SoilMPWKRLRRRTMAPSRPALYPDQIGLFVLTVAALAGGIYAALRYLL
Ga0247826_1038626023300030336SoilMAPSRPVLYPDQVGLFVLTVLAVGAGIYAALRFLL
Ga0268241_1009189813300030511SoilMWRRLRRRTLAPSRPAVYPDQIGLLVVTVIALAAGTYVVFRFLL
Ga0307501_1019888623300031152SoilMWKRLRRRTMAPSRPALYPDQVGLLVFSLLAVGGGIYVVVRLAFG
Ga0307501_1026448623300031152SoilMLWKRLRRRTMAPSRPALYPDQIGLFVISLIALGAGIYAA
Ga0307501_1027203513300031152SoilMWKRLRRRTFAPGRPAVYMEQVGLLVVTLAALAAGIYVVARF
Ga0307497_1033719323300031226SoilSKSPAMLWKRLRRRTMAPSRPALYPDQIGLFVITLIALGAGIYAAFRYLL
Ga0299913_1021188823300031229SoilMWKRLRRRTMAPSRPALYPDQVGLLLFSLLAIGGGIYAVARFLL
Ga0299913_1044965623300031229SoilMWKRLRRRTMAPGRPALHPDQVGLALFSLLALAGGIYAVARLLL
Ga0299913_1057356723300031229SoilMWKRLRRRTMAPGRPALYPDQVGLALFSLLALAGGIYAVARLLL
Ga0299913_1124048613300031229SoilMWKRFRRRTMAPGRPALYPDQVGLALFSLLALAGGIYAVARLLL
Ga0307408_10020919133300031548RhizosphereMAPSRPALYPDQIGLLVFTVAALAGGIYAALRYLL
Ga0307405_1022263423300031731RhizosphereMAPSRPVLYPDQIGLFVFTVAAIGGGIYAALRYLL
Ga0307406_1094370823300031901RhizosphereMPWKRLRRRTMAPSRPVLYPDQIGLLIFTLAALGAGIYAAFRYLL
Ga0308175_10327413523300031938SoilMWKRLRRRTFAPSRPAVYPDQIGLLIFTLIALLAGIYVVVRFLV
Ga0307409_10034747323300031995RhizosphereMWKRLRRRTFAPGRPAVHPDQVGLVVFTIAALAGGIYVVVRFLL
Ga0307409_10047697313300031995RhizosphereMWKRLRRRTFAPSRPAVFADQIGLLAITLVAMAAGIYVVARFLL
Ga0307411_1014494823300032005RhizosphereMAPSRPVLYPDQIGLFVFTVAALAGGIYAALRYLL
Ga0310890_1045331223300032075SoilLRRRTFAPSRPALYPDQIGLLIFTVAALAGGIYVVARYLL
Ga0326721_1065027223300032080SoilMAPSRPALYPDQIGLFVFTVGALGGGIYAAFRYLL
Ga0307415_10248875813300032126RhizosphereMAPSRPALYPDQIGLLIFTLAALGAGIYAAFRFLL
Ga0334947_107573_292_4023300034251Sub-Biocrust SoilMAPRRPAVFPEQIGLVIFIAVAMAVGIYFVLRVALA


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.