Basic Information | |
---|---|
Family ID | F017106 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 242 |
Average Sequence Length | 43 residues |
Representative Sequence | MWKRLRRRTFAPSRPAVYPDQIGLLIFTVAALAAGIYVVARFLL |
Number of Associated Samples | 144 |
Number of Associated Scaffolds | 242 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 37.08 % |
% of genes near scaffold ends (potentially truncated) | 17.77 % |
% of genes from short scaffolds (< 2000 bps) | 81.82 % |
Associated GOLD sequencing projects | 137 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.56 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (94.215 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (25.620 % of family members) |
Environment Ontology (ENVO) | Unclassified (27.273 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (52.479 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 44.44% β-sheet: 0.00% Coil/Unstructured: 55.56% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.56 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 242 Family Scaffolds |
---|---|---|
PF02771 | Acyl-CoA_dh_N | 66.94 |
PF01699 | Na_Ca_ex | 3.72 |
PF04305 | DUF455 | 2.48 |
PF01965 | DJ-1_PfpI | 1.65 |
PF03551 | PadR | 0.83 |
PF03738 | GSP_synth | 0.83 |
PF10604 | Polyketide_cyc2 | 0.41 |
PF07730 | HisKA_3 | 0.41 |
PF05935 | Arylsulfotrans | 0.41 |
PF00248 | Aldo_ket_red | 0.41 |
PF13420 | Acetyltransf_4 | 0.41 |
PF04389 | Peptidase_M28 | 0.41 |
PF08450 | SGL | 0.41 |
PF13279 | 4HBT_2 | 0.41 |
PF00903 | Glyoxalase | 0.41 |
PF05977 | MFS_3 | 0.41 |
PF13278 | Obsolete Pfam Family | 0.41 |
PF00583 | Acetyltransf_1 | 0.41 |
PF13338 | AbiEi_4 | 0.41 |
COG ID | Name | Functional Category | % Frequency in 242 Family Scaffolds |
---|---|---|---|
COG1960 | Acyl-CoA dehydrogenase related to the alkylation response protein AidB | Lipid transport and metabolism [I] | 66.94 |
COG0387 | Cation (Ca2+/Na+/K+)/H+ antiporter ChaA | Inorganic ion transport and metabolism [P] | 3.72 |
COG0530 | Ca2+/Na+ antiporter | Inorganic ion transport and metabolism [P] | 3.72 |
COG2833 | Uncharacterized protein, contains ferritin-like DUF455 domain | Function unknown [S] | 2.48 |
COG0754 | Glutathionylspermidine synthase, CHAP domain | Amino acid transport and metabolism [E] | 0.83 |
COG1695 | DNA-binding transcriptional regulator, PadR family | Transcription [K] | 0.83 |
COG1733 | DNA-binding transcriptional regulator, HxlR family | Transcription [K] | 0.83 |
COG1846 | DNA-binding transcriptional regulator, MarR family | Transcription [K] | 0.83 |
COG2814 | Predicted arabinose efflux permease AraJ, MFS family | Carbohydrate transport and metabolism [G] | 0.41 |
COG3386 | Sugar lactone lactonase YvrE | Carbohydrate transport and metabolism [G] | 0.41 |
COG3391 | DNA-binding beta-propeller fold protein YncE | General function prediction only [R] | 0.41 |
COG3850 | Signal transduction histidine kinase NarQ, nitrate/nitrite-specific | Signal transduction mechanisms [T] | 0.41 |
COG3851 | Signal transduction histidine kinase UhpB, glucose-6-phosphate specific | Signal transduction mechanisms [T] | 0.41 |
COG4564 | Signal transduction histidine kinase | Signal transduction mechanisms [T] | 0.41 |
COG4585 | Signal transduction histidine kinase ComP | Signal transduction mechanisms [T] | 0.41 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 94.21 % |
Unclassified | root | N/A | 5.79 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
2228664022|INPgaii200_c0576669 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei | 573 | Open in IMG/M |
3300000531|CNBas_1010912 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei | 556 | Open in IMG/M |
3300002547|JGI24973J35851_1017328 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1014 | Open in IMG/M |
3300002568|C688J35102_118610853 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei | 577 | Open in IMG/M |
3300002568|C688J35102_118998427 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei | 624 | Open in IMG/M |
3300002568|C688J35102_120509987 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei | 1130 | Open in IMG/M |
3300002568|C688J35102_120838726 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei | 1762 | Open in IMG/M |
3300003373|JGI25407J50210_10000288 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 9100 | Open in IMG/M |
3300003373|JGI25407J50210_10036759 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei | 1260 | Open in IMG/M |
3300003993|Ga0055468_10211411 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 600 | Open in IMG/M |
3300004081|Ga0063454_101944454 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei | 519 | Open in IMG/M |
3300004081|Ga0063454_101948344 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 518 | Open in IMG/M |
3300004156|Ga0062589_101671154 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 634 | Open in IMG/M |
3300004463|Ga0063356_103214048 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 704 | Open in IMG/M |
3300005045|Ga0071328_119876 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei | 2082 | Open in IMG/M |
3300005045|Ga0071328_157203 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei | 3412 | Open in IMG/M |
3300005332|Ga0066388_105339338 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 652 | Open in IMG/M |
3300005347|Ga0070668_101478695 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 621 | Open in IMG/M |
3300005366|Ga0070659_101699036 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 565 | Open in IMG/M |
3300005441|Ga0070700_100838128 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 744 | Open in IMG/M |
3300005457|Ga0070662_101653562 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 553 | Open in IMG/M |
3300005543|Ga0070672_101490002 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 606 | Open in IMG/M |
3300005578|Ga0068854_101250244 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 667 | Open in IMG/M |
3300005713|Ga0066905_101079167 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 712 | Open in IMG/M |
3300005718|Ga0068866_10534847 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 781 | Open in IMG/M |
3300005937|Ga0081455_10056584 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 3329 | Open in IMG/M |
3300006038|Ga0075365_10480654 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 878 | Open in IMG/M |
3300006048|Ga0075363_100796732 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → Thermoleophilum → Thermoleophilum album | 574 | Open in IMG/M |
3300006049|Ga0075417_10214631 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 915 | Open in IMG/M |
3300006049|Ga0075417_10514168 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 603 | Open in IMG/M |
3300006049|Ga0075417_10514336 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 603 | Open in IMG/M |
3300006058|Ga0075432_10013101 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 2817 | Open in IMG/M |
3300006844|Ga0075428_100040755 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → Thermoleophilum → Thermoleophilum album | 5108 | Open in IMG/M |
3300006844|Ga0075428_100772947 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 1021 | Open in IMG/M |
3300006844|Ga0075428_102536032 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 525 | Open in IMG/M |
3300006845|Ga0075421_102041898 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 610 | Open in IMG/M |
3300006846|Ga0075430_100222642 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 1565 | Open in IMG/M |
3300006876|Ga0079217_11188348 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 579 | Open in IMG/M |
3300006894|Ga0079215_10176307 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 1054 | Open in IMG/M |
3300006903|Ga0075426_11124950 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 595 | Open in IMG/M |
3300007790|Ga0105679_10883430 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 1189 | Open in IMG/M |
3300009090|Ga0099827_11176292 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → unclassified Thermoleophilaceae → Thermoleophilaceae bacterium | 666 | Open in IMG/M |
3300009094|Ga0111539_10544592 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 1352 | Open in IMG/M |
3300009094|Ga0111539_11969473 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 677 | Open in IMG/M |
3300009156|Ga0111538_13115444 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 578 | Open in IMG/M |
3300009553|Ga0105249_13013045 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → unclassified Thermoleophilaceae → Thermoleophilaceae bacterium | 541 | Open in IMG/M |
3300009789|Ga0126307_10000058 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 59420 | Open in IMG/M |
3300009789|Ga0126307_10000295 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 32299 | Open in IMG/M |
3300009789|Ga0126307_10071052 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → Thermoleophilum → Thermoleophilum album | 2740 | Open in IMG/M |
3300009789|Ga0126307_10073964 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → Thermoleophilum → Thermoleophilum album | 2684 | Open in IMG/M |
3300009789|Ga0126307_10074507 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 2674 | Open in IMG/M |
3300009789|Ga0126307_10113008 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → Thermoleophilum → Thermoleophilum album | 2158 | Open in IMG/M |
3300009789|Ga0126307_10281135 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → Thermoleophilum → Thermoleophilum album | 1339 | Open in IMG/M |
3300009789|Ga0126307_10342076 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1204 | Open in IMG/M |
3300009789|Ga0126307_11004206 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → Thermoleophilum → Thermoleophilum album | 674 | Open in IMG/M |
3300009789|Ga0126307_11092269 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → unclassified Thermoleophilaceae → Thermoleophilaceae bacterium | 645 | Open in IMG/M |
3300009840|Ga0126313_10002181 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 10818 | Open in IMG/M |
3300009840|Ga0126313_10068579 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 2545 | Open in IMG/M |
3300009840|Ga0126313_10143314 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 1797 | Open in IMG/M |
3300009840|Ga0126313_10232171 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 1426 | Open in IMG/M |
3300009840|Ga0126313_10294677 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → Thermoleophilum → Thermoleophilum album | 1267 | Open in IMG/M |
3300009840|Ga0126313_10499570 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → Thermoleophilum → Thermoleophilum album | 974 | Open in IMG/M |
3300009840|Ga0126313_10578126 | Not Available | 904 | Open in IMG/M |
3300009840|Ga0126313_10659511 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → Thermoleophilum → Thermoleophilum album | 846 | Open in IMG/M |
3300009840|Ga0126313_10904691 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 720 | Open in IMG/M |
3300009840|Ga0126313_11448043 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → unclassified Thermoleophilaceae → Thermoleophilaceae bacterium | 570 | Open in IMG/M |
3300009840|Ga0126313_11491235 | Not Available | 562 | Open in IMG/M |
3300010036|Ga0126305_10410257 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → Thermoleophilum → Thermoleophilum album | 894 | Open in IMG/M |
3300010037|Ga0126304_10325430 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 1020 | Open in IMG/M |
3300010038|Ga0126315_10010377 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 4390 | Open in IMG/M |
3300010039|Ga0126309_10018096 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → Thermoleophilum → Thermoleophilum album | 3037 | Open in IMG/M |
3300010039|Ga0126309_10018748 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → Thermoleophilum → Thermoleophilum album | 2991 | Open in IMG/M |
3300010039|Ga0126309_10038814 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 2218 | Open in IMG/M |
3300010039|Ga0126309_10087637 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 1577 | Open in IMG/M |
3300010039|Ga0126309_10100307 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 1489 | Open in IMG/M |
3300010039|Ga0126309_10169719 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 1187 | Open in IMG/M |
3300010039|Ga0126309_10249553 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 1005 | Open in IMG/M |
3300010039|Ga0126309_10435679 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 793 | Open in IMG/M |
3300010039|Ga0126309_10791430 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → unclassified Thermoleophilaceae → Thermoleophilaceae bacterium | 618 | Open in IMG/M |
3300010040|Ga0126308_10049690 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → Thermoleophilum → Thermoleophilum album | 2431 | Open in IMG/M |
3300010040|Ga0126308_10159541 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 1430 | Open in IMG/M |
3300010040|Ga0126308_10387261 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 931 | Open in IMG/M |
3300010040|Ga0126308_10431947 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 882 | Open in IMG/M |
3300010040|Ga0126308_11214634 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → unclassified Thermoleophilaceae → Thermoleophilaceae bacterium | 534 | Open in IMG/M |
3300010041|Ga0126312_10000603 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 21968 | Open in IMG/M |
3300010041|Ga0126312_10002093 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 13245 | Open in IMG/M |
3300010041|Ga0126312_10337370 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 1067 | Open in IMG/M |
3300010042|Ga0126314_10561779 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → unclassified Thermoleophilaceae → Thermoleophilaceae bacterium | 831 | Open in IMG/M |
3300010042|Ga0126314_11016399 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → unclassified Thermoleophilaceae → Thermoleophilaceae bacterium | 616 | Open in IMG/M |
3300010044|Ga0126310_10026894 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → Thermoleophilum → Thermoleophilum album | 2970 | Open in IMG/M |
3300010044|Ga0126310_10285843 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1129 | Open in IMG/M |
3300010044|Ga0126310_10355358 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 1029 | Open in IMG/M |
3300010044|Ga0126310_11083008 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 636 | Open in IMG/M |
3300010045|Ga0126311_10266623 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → unclassified Thermoleophilaceae → Thermoleophilaceae bacterium | 1277 | Open in IMG/M |
3300010045|Ga0126311_10338214 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 1144 | Open in IMG/M |
3300010045|Ga0126311_11305618 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → unclassified Thermoleophilaceae → Thermoleophilaceae bacterium | 603 | Open in IMG/M |
3300010047|Ga0126382_10248044 | Not Available | 1303 | Open in IMG/M |
3300010145|Ga0126321_1275724 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → unclassified Thermoleophilaceae → Thermoleophilaceae bacterium | 659 | Open in IMG/M |
3300010166|Ga0126306_10010592 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → Thermoleophilum → Thermoleophilum album | 5830 | Open in IMG/M |
3300010166|Ga0126306_10042275 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 3127 | Open in IMG/M |
3300010166|Ga0126306_10107462 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → Thermoleophilum → Thermoleophilum album | 2025 | Open in IMG/M |
3300010371|Ga0134125_12774917 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → unclassified Thermoleophilaceae → Thermoleophilaceae bacterium | 532 | Open in IMG/M |
3300010396|Ga0134126_11332338 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 795 | Open in IMG/M |
3300010399|Ga0134127_11148618 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 842 | Open in IMG/M |
3300010399|Ga0134127_11477965 | Not Available | 752 | Open in IMG/M |
3300012021|Ga0120192_10061189 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → unclassified Thermoleophilaceae → Thermoleophilaceae bacterium | 694 | Open in IMG/M |
3300012022|Ga0120191_10049795 | All Organisms → cellular organisms → Bacteria | 726 | Open in IMG/M |
3300012045|Ga0136623_10004531 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → Thermoleophilum → Thermoleophilum album | 5359 | Open in IMG/M |
3300012092|Ga0136621_1275322 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → unclassified Thermoleophilaceae → Thermoleophilaceae bacterium | 657 | Open in IMG/M |
3300012093|Ga0136632_10012182 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → Thermoleophilum → Thermoleophilum album | 3668 | Open in IMG/M |
3300012093|Ga0136632_10022313 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → Thermoleophilum → Thermoleophilum album | 2822 | Open in IMG/M |
3300012185|Ga0136619_10111297 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1049 | Open in IMG/M |
3300012188|Ga0136618_10143966 | All Organisms → cellular organisms → Bacteria | 1046 | Open in IMG/M |
3300012198|Ga0137364_10130825 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 1798 | Open in IMG/M |
3300012198|Ga0137364_11122678 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 591 | Open in IMG/M |
3300012204|Ga0137374_10523093 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → Thermoleophilum → Thermoleophilum album | 917 | Open in IMG/M |
3300012678|Ga0136615_10115184 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1292 | Open in IMG/M |
3300012680|Ga0136612_10033705 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 2570 | Open in IMG/M |
3300012680|Ga0136612_10048839 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 2127 | Open in IMG/M |
3300012680|Ga0136612_10251526 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 897 | Open in IMG/M |
3300012896|Ga0157303_10182618 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei | 591 | Open in IMG/M |
3300012897|Ga0157285_10171813 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 661 | Open in IMG/M |
3300012905|Ga0157296_10049256 | Not Available | 984 | Open in IMG/M |
3300012907|Ga0157283_10231440 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → unclassified Thermoleophilaceae → Thermoleophilaceae bacterium | 602 | Open in IMG/M |
3300012911|Ga0157301_10118236 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 803 | Open in IMG/M |
3300012939|Ga0162650_100072924 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → unclassified Thermoleophilaceae → Thermoleophilaceae bacterium | 587 | Open in IMG/M |
3300013012|Ga0169965_1034450 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1115 | Open in IMG/M |
3300013026|Ga0170681_1006124 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 2997 | Open in IMG/M |
3300013306|Ga0163162_12517912 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → unclassified Thermoleophilaceae → Thermoleophilaceae bacterium | 592 | Open in IMG/M |
3300013765|Ga0120172_1019268 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 2015 | Open in IMG/M |
3300014263|Ga0075324_1048197 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → unclassified Thermoleophilaceae → Thermoleophilaceae bacterium | 825 | Open in IMG/M |
3300014271|Ga0075326_1074963 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 928 | Open in IMG/M |
3300014302|Ga0075310_1086261 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → unclassified Thermoleophilaceae → Thermoleophilaceae bacterium | 651 | Open in IMG/M |
3300014488|Ga0182001_10275195 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → unclassified Thermoleophilaceae → Thermoleophilaceae bacterium | 666 | Open in IMG/M |
3300015373|Ga0132257_102855079 | All Organisms → cellular organisms → Bacteria | 630 | Open in IMG/M |
3300017787|Ga0183260_10101857 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 2078 | Open in IMG/M |
3300017787|Ga0183260_10749667 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 615 | Open in IMG/M |
3300017789|Ga0136617_10068021 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 3121 | Open in IMG/M |
3300017789|Ga0136617_10210520 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → unclassified Thermoleophilaceae → Thermoleophilaceae bacterium | 1635 | Open in IMG/M |
3300017789|Ga0136617_10559982 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 901 | Open in IMG/M |
3300017789|Ga0136617_10604861 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Sorangiineae → Polyangiaceae → unclassified Polyangiaceae → Polyangiaceae bacterium | 859 | Open in IMG/M |
3300018028|Ga0184608_10412678 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → unclassified Thermoleophilaceae → Thermoleophilaceae bacterium | 585 | Open in IMG/M |
3300018061|Ga0184619_10164785 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → Thermoleophilum → Thermoleophilum album | 1014 | Open in IMG/M |
3300018061|Ga0184619_10398601 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → unclassified Thermoleophilaceae → Thermoleophilaceae bacterium | 622 | Open in IMG/M |
3300018061|Ga0184619_10506950 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → unclassified Thermoleophilaceae → Thermoleophilaceae bacterium | 532 | Open in IMG/M |
3300018073|Ga0184624_10121460 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → Thermoleophilum → Thermoleophilum album | 1132 | Open in IMG/M |
3300018422|Ga0190265_10003263 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 11047 | Open in IMG/M |
3300018422|Ga0190265_10034756 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → Thermoleophilum → Thermoleophilum album | 4235 | Open in IMG/M |
3300018422|Ga0190265_10402981 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → Thermoleophilum → Thermoleophilum album | 1466 | Open in IMG/M |
3300018422|Ga0190265_11145943 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 897 | Open in IMG/M |
3300018422|Ga0190265_11547624 | Not Available | 776 | Open in IMG/M |
3300018422|Ga0190265_13136598 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 552 | Open in IMG/M |
3300018429|Ga0190272_10322873 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1211 | Open in IMG/M |
3300018429|Ga0190272_10761184 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 884 | Open in IMG/M |
3300018429|Ga0190272_11206442 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 744 | Open in IMG/M |
3300018432|Ga0190275_10533797 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → Thermoleophilum → Thermoleophilum album | 1212 | Open in IMG/M |
3300018432|Ga0190275_10891144 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → unclassified Thermoleophilaceae → Thermoleophilaceae bacterium | 957 | Open in IMG/M |
3300018432|Ga0190275_11146528 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 852 | Open in IMG/M |
3300018432|Ga0190275_11452494 | All Organisms → cellular organisms → Bacteria | 763 | Open in IMG/M |
3300018432|Ga0190275_11612117 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → unclassified Thermoleophilaceae → Thermoleophilaceae bacterium | 727 | Open in IMG/M |
3300018432|Ga0190275_12242419 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 624 | Open in IMG/M |
3300018465|Ga0190269_10483022 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 798 | Open in IMG/M |
3300018465|Ga0190269_10800866 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 678 | Open in IMG/M |
3300018466|Ga0190268_10340628 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → Thermoleophilum → Thermoleophilum album | 927 | Open in IMG/M |
3300018466|Ga0190268_11648954 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei | 568 | Open in IMG/M |
3300018466|Ga0190268_11662024 | Not Available | 567 | Open in IMG/M |
3300018469|Ga0190270_10065006 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → Thermoleophilum → Thermoleophilum album | 2621 | Open in IMG/M |
3300018469|Ga0190270_10921914 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 893 | Open in IMG/M |
3300018469|Ga0190270_11200952 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 797 | Open in IMG/M |
3300018469|Ga0190270_11562167 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → unclassified Thermoleophilaceae → Thermoleophilaceae bacterium | 710 | Open in IMG/M |
3300018469|Ga0190270_13425528 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → unclassified Thermoleophilaceae → Thermoleophilaceae bacterium | 503 | Open in IMG/M |
3300018476|Ga0190274_10383207 | Not Available | 1354 | Open in IMG/M |
3300018476|Ga0190274_12646046 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → unclassified Thermoleophilaceae → Thermoleophilaceae bacterium | 599 | Open in IMG/M |
3300019356|Ga0173481_10332081 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 719 | Open in IMG/M |
3300019356|Ga0173481_10564869 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 592 | Open in IMG/M |
3300019377|Ga0190264_11107548 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 646 | Open in IMG/M |
3300019377|Ga0190264_11227078 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 625 | Open in IMG/M |
3300019767|Ga0190267_11495795 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 520 | Open in IMG/M |
3300019865|Ga0193748_1001264 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 1606 | Open in IMG/M |
3300019884|Ga0193741_1047826 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → Thermoleophilum → Thermoleophilum album | 1103 | Open in IMG/M |
3300021184|Ga0196959_10110801 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → unclassified Thermoleophilaceae → Thermoleophilaceae bacterium | 640 | Open in IMG/M |
3300021339|Ga0193706_1004372 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 5515 | Open in IMG/M |
3300022756|Ga0222622_10722203 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 725 | Open in IMG/M |
3300025791|Ga0210115_1019035 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → Thermoleophilum → Thermoleophilum album | 1565 | Open in IMG/M |
3300025919|Ga0207657_11207382 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → unclassified Thermoleophilaceae → Thermoleophilaceae bacterium | 575 | Open in IMG/M |
3300025934|Ga0207686_10450461 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → Thermoleophilum → Thermoleophilum album | 990 | Open in IMG/M |
3300025937|Ga0207669_11166755 | Not Available | 652 | Open in IMG/M |
3300025944|Ga0207661_10948055 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → Thermoleophilum → Thermoleophilum album | 793 | Open in IMG/M |
3300025945|Ga0207679_11579211 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei | 601 | Open in IMG/M |
3300025949|Ga0207667_12109067 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → unclassified Thermoleophilaceae → Thermoleophilaceae bacterium | 522 | Open in IMG/M |
3300026075|Ga0207708_10807533 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 808 | Open in IMG/M |
3300026118|Ga0207675_101573955 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → unclassified Thermoleophilaceae → Thermoleophilaceae bacterium | 678 | Open in IMG/M |
3300027638|Ga0208612_1001662 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 9162 | Open in IMG/M |
3300027691|Ga0209485_1022688 | Not Available | 1452 | Open in IMG/M |
3300027873|Ga0209814_10238594 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 787 | Open in IMG/M |
3300027907|Ga0207428_10481260 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → unclassified Thermoleophilaceae → Thermoleophilaceae bacterium | 903 | Open in IMG/M |
3300027909|Ga0209382_10086280 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 3694 | Open in IMG/M |
3300027909|Ga0209382_10435861 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → Thermoleophilum → Thermoleophilum album | 1454 | Open in IMG/M |
3300027909|Ga0209382_11655316 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei | 630 | Open in IMG/M |
3300028589|Ga0247818_10254927 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1160 | Open in IMG/M |
3300028704|Ga0307321_1062498 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei | 719 | Open in IMG/M |
3300028705|Ga0307276_10004223 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 2261 | Open in IMG/M |
3300028705|Ga0307276_10054564 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → Thermoleophilum → Thermoleophilum album | 893 | Open in IMG/M |
3300028705|Ga0307276_10106594 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 682 | Open in IMG/M |
3300028707|Ga0307291_1171535 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → unclassified Thermoleophilaceae → Thermoleophilaceae bacterium | 556 | Open in IMG/M |
3300028713|Ga0307303_10085016 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei | 710 | Open in IMG/M |
3300028714|Ga0307309_10165412 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 567 | Open in IMG/M |
3300028721|Ga0307315_10034995 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 1356 | Open in IMG/M |
3300028744|Ga0307318_10218708 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Thermoanaerobacterales → Thermoanaerobacteraceae → Carboxydothermus | 660 | Open in IMG/M |
3300028755|Ga0307316_10182760 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 753 | Open in IMG/M |
3300028814|Ga0307302_10433581 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → unclassified Thermoleophilaceae → Thermoleophilaceae bacterium | 651 | Open in IMG/M |
3300028876|Ga0307286_10214027 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → unclassified Thermoleophilaceae → Thermoleophilaceae bacterium | 701 | Open in IMG/M |
3300028878|Ga0307278_10394296 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei | 609 | Open in IMG/M |
3300028880|Ga0307300_10065567 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 1051 | Open in IMG/M |
3300028889|Ga0247827_10045801 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1975 | Open in IMG/M |
3300030006|Ga0299907_10026681 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → Thermoleophilum → Thermoleophilum album | 4430 | Open in IMG/M |
3300030006|Ga0299907_11354826 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 503 | Open in IMG/M |
3300030336|Ga0247826_10155087 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 1514 | Open in IMG/M |
3300030336|Ga0247826_10186438 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1406 | Open in IMG/M |
3300030336|Ga0247826_10386260 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → Thermoleophilum → Thermoleophilum album | 1030 | Open in IMG/M |
3300030511|Ga0268241_10091898 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → unclassified Thermoleophilaceae → Thermoleophilaceae bacterium | 696 | Open in IMG/M |
3300031152|Ga0307501_10198886 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 572 | Open in IMG/M |
3300031152|Ga0307501_10264486 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → unclassified Thermoleophilaceae → Thermoleophilaceae bacterium | 517 | Open in IMG/M |
3300031152|Ga0307501_10272035 | Not Available | 512 | Open in IMG/M |
3300031226|Ga0307497_10337193 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → unclassified Thermoleophilaceae → Thermoleophilaceae bacterium | 703 | Open in IMG/M |
3300031229|Ga0299913_10211888 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 1918 | Open in IMG/M |
3300031229|Ga0299913_10449656 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 1275 | Open in IMG/M |
3300031229|Ga0299913_10573567 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → Thermoleophilum → Thermoleophilum album | 1112 | Open in IMG/M |
3300031229|Ga0299913_11240486 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 704 | Open in IMG/M |
3300031548|Ga0307408_100209191 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → Thermoleophilum → Thermoleophilum album | 1584 | Open in IMG/M |
3300031731|Ga0307405_10222634 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → Thermoleophilum → Thermoleophilum album | 1385 | Open in IMG/M |
3300031901|Ga0307406_10943708 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → unclassified Thermoleophilaceae → Thermoleophilaceae bacterium | 737 | Open in IMG/M |
3300031938|Ga0308175_103274135 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 502 | Open in IMG/M |
3300031995|Ga0307409_100347473 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → Thermoleophilum → Thermoleophilum album | 1398 | Open in IMG/M |
3300031995|Ga0307409_100476973 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1210 | Open in IMG/M |
3300032005|Ga0307411_10144948 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → Thermoleophilum → Thermoleophilum album | 1756 | Open in IMG/M |
3300032075|Ga0310890_10453312 | Not Available | 965 | Open in IMG/M |
3300032080|Ga0326721_10650272 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → Thermoleophilum → Thermoleophilum album | 646 | Open in IMG/M |
3300032126|Ga0307415_102488758 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → unclassified Thermoleophilaceae → Thermoleophilaceae bacterium | 510 | Open in IMG/M |
3300034251|Ga0334947_107573 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → unclassified Thermoleophilaceae → Thermoleophilaceae bacterium | 582 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 25.62% |
Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 21.90% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 7.44% |
Polar Desert Sand | Environmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert Sand | 6.61% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 2.89% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 2.89% |
Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 2.48% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 2.07% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 1.65% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.65% |
Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 1.65% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil | 1.65% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 1.65% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.24% |
Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 1.24% |
Polar Desert | Environmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert | 0.83% |
Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 0.83% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.83% |
Terrestrial | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial | 0.83% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.83% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 0.83% |
Soil | Environmental → Terrestrial → Soil → Sand → Desert → Soil | 0.83% |
Rock | Environmental → Terrestrial → Rock-Dwelling (Subaerial Biofilms) → Unclassified → Unclassified → Rock | 0.83% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.83% |
Populus Endosphere | Host-Associated → Plants → Roots → Bulk Soil → Unclassified → Populus Endosphere | 0.83% |
Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Unclassified → Tabebuia Heterophylla Rhizosphere | 0.83% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.83% |
Soil | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil | 0.41% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.41% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 0.41% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.41% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 0.41% |
Sub-Biocrust Soil | Environmental → Terrestrial → Soil → Unclassified → Desert → Sub-Biocrust Soil | 0.41% |
Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.41% |
Soil | Environmental → Terrestrial → Agricultural Field → Unclassified → Unclassified → Soil | 0.41% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.41% |
Quercus Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Quercus Rhizosphere | 0.41% |
Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 0.41% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.41% |
Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 0.41% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.41% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.41% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.41% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.41% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.41% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
2228664022 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
3300000531 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNB_Illumina_Assembled | Host-Associated | Open in IMG/M |
3300001537 | Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A20-65 cm-11A)- 1 week illumina | Environmental | Open in IMG/M |
3300002547 | Polar desert microbial communities from Antarctic Dry Valleys - UQ889 | Environmental | Open in IMG/M |
3300002568 | Grasslands soil microbial communities from Hopland, California, USA - 2 | Environmental | Open in IMG/M |
3300003373 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Host-Associated | Open in IMG/M |
3300003993 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailC_D2 | Environmental | Open in IMG/M |
3300004081 | Grasslands soil microbial communities from Hopland, California, USA - 2 (version 2) | Environmental | Open in IMG/M |
3300004156 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1 | Environmental | Open in IMG/M |
3300004463 | Combined assembly of Arabidopsis thaliana microbial communities | Host-Associated | Open in IMG/M |
3300005045 | Permafrost microbial communities from Fox Tunnel, Fairbanks, Alaska, USA | Environmental | Open in IMG/M |
3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Host-Associated | Open in IMG/M |
3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Host-Associated | Open in IMG/M |
3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Environmental | Open in IMG/M |
3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Host-Associated | Open in IMG/M |
3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Host-Associated | Open in IMG/M |
3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Host-Associated | Open in IMG/M |
3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Host-Associated | Open in IMG/M |
3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Host-Associated | Open in IMG/M |
3300006038 | Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Host-Associated | Open in IMG/M |
3300006048 | Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Host-Associated | Open in IMG/M |
3300006049 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 | Host-Associated | Open in IMG/M |
3300006058 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Host-Associated | Open in IMG/M |
3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
3300006846 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Host-Associated | Open in IMG/M |
3300006876 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS200 | Environmental | Open in IMG/M |
3300006894 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Control | Environmental | Open in IMG/M |
3300006903 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5 | Host-Associated | Open in IMG/M |
3300007790 | Microbial communities of desert soil contaminated with blood from dead anthrax infected zebra in Etosha National Park, Namibia. Combined Assembly of 14 sequencing projects | Environmental | Open in IMG/M |
3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
3300009789 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot28 | Environmental | Open in IMG/M |
3300009840 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105A | Environmental | Open in IMG/M |
3300010036 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot26 | Environmental | Open in IMG/M |
3300010037 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot25 | Environmental | Open in IMG/M |
3300010038 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot106 | Environmental | Open in IMG/M |
3300010039 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot56 | Environmental | Open in IMG/M |
3300010040 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot55 | Environmental | Open in IMG/M |
3300010041 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot104A | Environmental | Open in IMG/M |
3300010042 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105B | Environmental | Open in IMG/M |
3300010044 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot60 | Environmental | Open in IMG/M |
3300010045 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot61 | Environmental | Open in IMG/M |
3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
3300010145 | Soil microbial communities from Hawaii, USA to study soil gas exchange rates - KP-HI-INT metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300010166 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot27 | Environmental | Open in IMG/M |
3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
3300012021 | Terrestrial microbial communites from a soil warming plot in Okalahoma, USA - T1 | Environmental | Open in IMG/M |
3300012022 | Terrestrial microbial communites from a soil warming plot in Okalahoma, USA - C6 | Environmental | Open in IMG/M |
3300012045 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ449 (21.06) | Environmental | Open in IMG/M |
3300012092 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ445A (23.06) | Environmental | Open in IMG/M |
3300012093 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ611 (21.06) | Environmental | Open in IMG/M |
3300012185 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ353 (21.06) | Environmental | Open in IMG/M |
3300012188 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ330 (21.06) | Environmental | Open in IMG/M |
3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
3300012204 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaG | Environmental | Open in IMG/M |
3300012678 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ288 (22.06) | Environmental | Open in IMG/M |
3300012680 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ224A (23.06) | Environmental | Open in IMG/M |
3300012896 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S118-311C-2 | Environmental | Open in IMG/M |
3300012897 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S074-202C-1 | Environmental | Open in IMG/M |
3300012905 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S013-104B-2 | Environmental | Open in IMG/M |
3300012907 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S044-104R-1 | Environmental | Open in IMG/M |
3300012911 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S088-202R-2 | Environmental | Open in IMG/M |
3300012939 | Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t1i015 | Environmental | Open in IMG/M |
3300012957 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG | Environmental | Open in IMG/M |
3300013012 | Gypsum rock endolithic microbial communities from the Atacama Desert, Chile - Cordon de Lila | Environmental | Open in IMG/M |
3300013026 | Gypsum rock hypoendolithic microbial communities from the Atacama Desert, Chile - Cordon de Lila | Environmental | Open in IMG/M |
3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
3300013765 | Permafrost microbial communities from Nunavut, Canada - A30_80cm_6M | Environmental | Open in IMG/M |
3300014263 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleC_D1 | Environmental | Open in IMG/M |
3300014271 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberrySE_CattailA_D2 | Environmental | Open in IMG/M |
3300014302 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNE_CattailA_D2 | Environmental | Open in IMG/M |
3300014488 | Bulk soil microbial communities from Mexico - San Felipe (SF) metaG | Environmental | Open in IMG/M |
3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
3300017787 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ497 (22.06) (version 2) | Environmental | Open in IMG/M |
3300017789 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ322 (21.06) | Environmental | Open in IMG/M |
3300018028 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_coex | Environmental | Open in IMG/M |
3300018061 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_b1 | Environmental | Open in IMG/M |
3300018073 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_5_b1 | Environmental | Open in IMG/M |
3300018422 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 T | Environmental | Open in IMG/M |
3300018429 | Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 T | Environmental | Open in IMG/M |
3300018432 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 550 T | Environmental | Open in IMG/M |
3300018465 | Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 IS | Environmental | Open in IMG/M |
3300018466 | Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 T | Environmental | Open in IMG/M |
3300018469 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 T | Environmental | Open in IMG/M |
3300018476 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 T | Environmental | Open in IMG/M |
3300019356 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S073-202C-2 (version 2) | Environmental | Open in IMG/M |
3300019377 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 112 T | Environmental | Open in IMG/M |
3300019767 | Populus adjacent soil microbial communities from riparian zone of Oak Creek, Arizona, USA - 239 T | Environmental | Open in IMG/M |
3300019865 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1s1 | Environmental | Open in IMG/M |
3300019884 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L2s2 | Environmental | Open in IMG/M |
3300021184 | Soil microbial communities from Anza Borrego desert, Southern California, United States - S1+v_20 | Environmental | Open in IMG/M |
3300021339 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3c1 | Environmental | Open in IMG/M |
3300022756 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1 | Environmental | Open in IMG/M |
3300025791 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleB_D2 (SPAdes) | Environmental | Open in IMG/M |
3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) | Environmental | Open in IMG/M |
3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300027638 | Polar desert microbial communities from Antarctic Dry Valleys - UQ889 (SPAdes) | Environmental | Open in IMG/M |
3300027691 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS100 (SPAdes) | Environmental | Open in IMG/M |
3300027873 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 (SPAdes) | Host-Associated | Open in IMG/M |
3300027907 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) | Host-Associated | Open in IMG/M |
3300027909 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes) | Host-Associated | Open in IMG/M |
3300028589 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Glucose_Day1 | Environmental | Open in IMG/M |
3300028704 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_379 | Environmental | Open in IMG/M |
3300028705 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_115 | Environmental | Open in IMG/M |
3300028707 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_148 | Environmental | Open in IMG/M |
3300028713 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_184 | Environmental | Open in IMG/M |
3300028714 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_196 | Environmental | Open in IMG/M |
3300028721 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_355 | Environmental | Open in IMG/M |
3300028744 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_367 | Environmental | Open in IMG/M |
3300028755 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_356 | Environmental | Open in IMG/M |
3300028814 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_183 | Environmental | Open in IMG/M |
3300028876 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_140 | Environmental | Open in IMG/M |
3300028878 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_117 | Environmental | Open in IMG/M |
3300028880 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_181 | Environmental | Open in IMG/M |
3300028889 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day2 | Environmental | Open in IMG/M |
3300030006 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT152D67 | Environmental | Open in IMG/M |
3300030336 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day1 | Environmental | Open in IMG/M |
3300030511 | Bulk soil microbial communities from Mexico - Amatitan (Am) metaG (v2) | Environmental | Open in IMG/M |
3300031152 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 15_S | Environmental | Open in IMG/M |
3300031226 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 10_S | Environmental | Open in IMG/M |
3300031229 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT155D38 | Environmental | Open in IMG/M |
3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Host-Associated | Open in IMG/M |
3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Host-Associated | Open in IMG/M |
3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Host-Associated | Open in IMG/M |
3300031938 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1 | Environmental | Open in IMG/M |
3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Host-Associated | Open in IMG/M |
3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Host-Associated | Open in IMG/M |
3300032075 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D3 | Environmental | Open in IMG/M |
3300032080 | Soil microbial communities from Southern Great Plains, Lamont, Oklahoma, United States - SGP_1_2016 | Environmental | Open in IMG/M |
3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Host-Associated | Open in IMG/M |
3300034251 | Sub-biocrust soil microbial communities from Mojave Desert, California, United States - 43SMS | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
INPgaii200_05766692 | 2228664022 | Soil | MWKRLRRRTLAPSRPAVFPDQIGLLAITVIAMAAGIYVVVRFLL |
CNBas_10109121 | 3300000531 | Quercus Rhizosphere | MWKRLRRRSFAPGRPAVYMEQIGLLVVTLVAMAVGIYVVARFLL* |
A2065W1_100575302 | 3300001537 | Permafrost | MWKRLRRRTMAPSRPLLYPDQIGLLVFTLIAIGVGAWFVVRLAFG* |
JGI24973J35851_10173282 | 3300002547 | Polar Desert | VWKRLRRRSFAPGRPAVYDDQVGLVVFVVVALGAGIYFAVKLAI* |
C688J35102_1186108532 | 3300002568 | Soil | MWKRLRRRTFAPSRPAVYPEQIGLLIFTVVALLTGIYVVARFLL* |
C688J35102_1189984272 | 3300002568 | Soil | MWKRLRRRTFAPSRPAVYPDQIGLLVFTIAALVVGTYVVVRFLL* |
C688J35102_1205099872 | 3300002568 | Soil | MWKRLRRRTMAPSRPALYPDQVGLLVFSLLAVAGGIYAVVRLLLA* |
C688J35102_1208387264 | 3300002568 | Soil | MWKRLRRRTMAPSRPALYPEQVGLLVFSLLAVGGGIYVAVRLAFG* |
JGI25407J50210_100002889 | 3300003373 | Tabebuia Heterophylla Rhizosphere | MWRRLRRRTMAPSTPAVYPDQLGLVVFTVVALAVGIYAAARWLL* |
JGI25407J50210_100367592 | 3300003373 | Tabebuia Heterophylla Rhizosphere | MWKRLRRRTLAPSRPALYPDQAGLVFFIVLASGIGIYAVVRFLL* |
Ga0055468_102114112 | 3300003993 | Natural And Restored Wetlands | MWKRFRRRTFAPSRPALYADQIGLALFSVAALVIGTYVVARFLL* |
Ga0063454_1019444542 | 3300004081 | Soil | MWKRLRRRTFAPSRPALYGDQLGLLLVCLLVIGLGMYVVVRVLFG* |
Ga0063454_1019483441 | 3300004081 | Soil | MWKRLRRRTFAPSRPAVYPEQVGLLLITLLVIAGGIWVFVKVL* |
Ga0062589_1016711542 | 3300004156 | Soil | MWKRLRRRTFAPSRPAVYPDQIGLLIFTVAALAAGIYVVARFLL* |
Ga0063356_1032140482 | 3300004463 | Arabidopsis Thaliana Rhizosphere | MWKRLRRRSLAPGRPALYPDQIGLAFFSVVALAGGIYVVVRFLL* |
Ga0071328_1198763 | 3300005045 | Permafrost | MWRRFRRRSMAPSRPALYPDQIGLLIFTLAALASGIWAVVHYIL* |
Ga0071328_1572031 | 3300005045 | Permafrost | MPWKRLRRRTLAPSRPALYPDQIGLFVFSLAAIGAGLYAAFRFLL* |
Ga0066388_1053393382 | 3300005332 | Tropical Forest Soil | MWKRLRRRTFAPSRPALFPDQIGLLVITLVAMGAGIYVVARFLL* |
Ga0070668_1014786951 | 3300005347 | Switchgrass Rhizosphere | MPWKNLRRRTMAPSRPALYPDQVGLFVLTVLALGAGIYAALRFLL* |
Ga0070659_1016990362 | 3300005366 | Corn Rhizosphere | KRLRRRTFAPSRPAVYPDQIGLLMFTVVAVAGGIYVVARFLL* |
Ga0070700_1008381282 | 3300005441 | Corn, Switchgrass And Miscanthus Rhizosphere | MWKRLRRRTFAPSRPAVYPDQIGLLIVTVLALLAGTYVVVRFLL* |
Ga0070662_1016535621 | 3300005457 | Corn Rhizosphere | HGHSFPGMWRRLRRRTFAPSRPAVFPDQIGLLVITLAAMGVGIYVVARFLL* |
Ga0070672_1014900022 | 3300005543 | Miscanthus Rhizosphere | MWKRLRRRTFAPSRPALFPDQIGLLVITLLAMGAGIYVVARFLL* |
Ga0068854_1012502442 | 3300005578 | Corn Rhizosphere | MWKRLRRRTFAPSRPAVYPDQIGLLIVTALALLAGTYVVLRFLL* |
Ga0066905_1010791672 | 3300005713 | Tropical Forest Soil | MGSLHPMWKRLRRRTFAPSRPAVFPDQVGLLAITVVAMAIGIYVVVRFLL* |
Ga0068866_105348472 | 3300005718 | Miscanthus Rhizosphere | MWKRLRRRTFAPSRPAVFADQIGLLAITVVAMAAGIYVVARFLL* |
Ga0081455_100565845 | 3300005937 | Tabebuia Heterophylla Rhizosphere | MPWKRLRRRSMAPSRPAVYPDQIGLVLFTVIAIAVGIWAVFRYLL* |
Ga0075365_104806543 | 3300006038 | Populus Endosphere | MPWKRLRRRTMAPSRPAVYPDQIGLLVFTLAALGAGIYAAFRYLL* |
Ga0075363_1007967322 | 3300006048 | Populus Endosphere | MAPSRPAVYPDQIGLLVFTLAALGAGIYAAFRYLL* |
Ga0075417_102146311 | 3300006049 | Populus Rhizosphere | MWKRLRRRSLAPGRPAVYPDQIGLLVFTLAALAGGIYVVVRFLL* |
Ga0075417_105141682 | 3300006049 | Populus Rhizosphere | KRLRRRSMAPSRPALYPDQIGLFVLTMAALGAGIYAVVRYLL* |
Ga0075417_105143361 | 3300006049 | Populus Rhizosphere | MWKRLRRRTFAPSRPALFPDQIGLLAITLVAMGVGIYVAARFLL* |
Ga0075432_100131012 | 3300006058 | Populus Rhizosphere | MWKRLRRRTFAPSRPALYPDQIGLLIFTVAALAGGIYVVARYLL* |
Ga0075428_1000407555 | 3300006844 | Populus Rhizosphere | MAPSRPALYPDQIGLFVFTVAALGAGIYAALRYLL* |
Ga0075428_1007729472 | 3300006844 | Populus Rhizosphere | MWKRLRRRTFAPSRPAVYPDQVGLLFFTAIALIVGIYVVARFLL* |
Ga0075428_1025360321 | 3300006844 | Populus Rhizosphere | LRRRTMAPSRPAVYPDQIGLLVFTLAALGAGIYAAFRYLL* |
Ga0075421_1020418982 | 3300006845 | Populus Rhizosphere | MWKRLRRRTFAPSRPAVYPDQIGLLIFTVIALAAGTYVVFRFLL* |
Ga0075430_1002226422 | 3300006846 | Populus Rhizosphere | MWKRLRRRTFAPSRPAVYPDQIGLLFFTVIALIAGIYVVVRFLL* |
Ga0079217_111883482 | 3300006876 | Agricultural Soil | MWRRFRRRTLAPGRPALYPDQVGLALFSLLAIVAGIYVVVRFLL* |
Ga0079215_101763072 | 3300006894 | Agricultural Soil | RRLRRRTFAPSRPAVFPDQIGLLVFTLVAMAVGIYVVARFLL* |
Ga0075426_111249501 | 3300006903 | Populus Rhizosphere | TFAPSRPALYPDQIGLLIFTVAALAGGIYVVARYLL* |
Ga0105679_108834302 | 3300007790 | Soil | MAPSRPALFPDQYGLFALTLLAIGAGIYAAFRFLL* |
Ga0099827_111762922 | 3300009090 | Vadose Zone Soil | MAPSRPALYPDQVGLLIFTLAALGGGIWAVAHFVF* |
Ga0111539_105445922 | 3300009094 | Populus Rhizosphere | MWKRLRRRTFAPSRPALFPDQIGLLAITLVAMAAGIYVVARFLL* |
Ga0111539_119694731 | 3300009094 | Populus Rhizosphere | MWKRLRRRTFAPSRPAVYPDQIGLLMFTVVAVAGGIYVVARFLL* |
Ga0111538_131154442 | 3300009156 | Populus Rhizosphere | MWKRLRRRTFAPSRPAVFADQIGLLVITVIAMAAGIYVVARFLL* |
Ga0105249_130130452 | 3300009553 | Switchgrass Rhizosphere | LRRRTMSPGRPLLYPDQIGLALFTLIALAVGIFAVVRYLL* |
Ga0126307_1000005851 | 3300009789 | Serpentine Soil | MWKRLRRPTFAPSRPALHQDQIGLLVFVVLALGAGIYFALRFAL* |
Ga0126307_1000029540 | 3300009789 | Serpentine Soil | MWKRLRRRSMAPSRPALYFDQIGLAVFTVVALAVGTYLAFRYLL* |
Ga0126307_100710524 | 3300009789 | Serpentine Soil | MAPSRPVLYPDQIGLFVFTVAAIGGGIYAALRYLL* |
Ga0126307_100739642 | 3300009789 | Serpentine Soil | MWKRLRRGSLAPGRPVIYTEQVGLLVVTVVALAVGIYVVARFLL* |
Ga0126307_100745072 | 3300009789 | Serpentine Soil | MWKRLRRRTFAPSRPAVYPDQIGLLLLTVLALGAGTYVVFRFLL* |
Ga0126307_101130082 | 3300009789 | Serpentine Soil | MSWKRLRRRSMAPSRPALYPDQIGLFVFTVAALGAGIYAAFRFLL* |
Ga0126307_102811353 | 3300009789 | Serpentine Soil | LAPGRPALYPDQIGLAVVTVAALAGGIYVVARFLL* |
Ga0126307_103420761 | 3300009789 | Serpentine Soil | MFWQRLRRRTMTPSRPALHPDQVGLLVFTVLALGVGIYAAVRLLVA* |
Ga0126307_110042062 | 3300009789 | Serpentine Soil | MWKRLRRRTFTPSRPAVYPDQIGLLFFTLIALAVGIGVVLRFLL* |
Ga0126307_110922691 | 3300009789 | Serpentine Soil | MAPSRPVLYPDQIGLFVFTLAALGGGIYAALRYLL* |
Ga0126313_1000218112 | 3300009840 | Serpentine Soil | MWKRLRRKTIAPGRPALYADQVGLLGFSLIAVAGGIYIAVRLAFG* |
Ga0126313_100685792 | 3300009840 | Serpentine Soil | MWKRLRRRTFAPSRPALHQDQIGLLVFVVLALGAGIYFALRFAL* |
Ga0126313_101433142 | 3300009840 | Serpentine Soil | MWKRLRRRTFAPSRPAVYPDQIGLLVFTVIALGTGTYAVVRFLL* |
Ga0126313_102321714 | 3300009840 | Serpentine Soil | MWKRLRRRSFAPSRPAVFADQIGLLAVTLVAMATGIYVVARFLL* |
Ga0126313_102946772 | 3300009840 | Serpentine Soil | MWKRLRRRTFAPDRPAVYPDQVGLVVFTIAALAGGIYVVVRFLL* |
Ga0126313_104995702 | 3300009840 | Serpentine Soil | MAPSRPALHPDQIGLFVLTVAAIGAGIYAALRFLM* |
Ga0126313_105781261 | 3300009840 | Serpentine Soil | MWKRLRRRTFAPSRPAVYADQIGLLVVTLVAMAAGTYVVVRFLL* |
Ga0126313_106595113 | 3300009840 | Serpentine Soil | MWKRLRRRSLEPGRPALYRDQIGLAVVTLAALASGIYVVARFLL* |
Ga0126313_109046912 | 3300009840 | Serpentine Soil | MWKRLRRRTMAPSRPALYPDQVGLLVFTLLALGVGIFVVVRLVLG* |
Ga0126313_114480431 | 3300009840 | Serpentine Soil | MAPSRPALYPDQVGLLVFTLLALGIGTYAVVRFLL* |
Ga0126313_114912352 | 3300009840 | Serpentine Soil | MWKRMRRRTFAPSRPAVFPDQIGLLAVTLVAMGVGIYVVARFLL* |
Ga0126305_104102572 | 3300010036 | Serpentine Soil | MWKRLRRKTMAPGRPALYADQVGLLGFSLIAVAGGIYIAVRLAFG* |
Ga0126304_103254302 | 3300010037 | Serpentine Soil | MWKRLRRRTFAPGRPAVYPDQIGLLVFTLVALAAGIYVVVRFLL* |
Ga0126315_100103776 | 3300010038 | Serpentine Soil | MWKRLRRRTFAPSRPAVYADQIGLLVVTLVAMAAGIYVVVRFLL* |
Ga0126309_100180962 | 3300010039 | Serpentine Soil | MWKRLRRRTFAPSRPAVYPEQIGLLFFTLIALLAGIYVVARFLL* |
Ga0126309_100187482 | 3300010039 | Serpentine Soil | MWKRLRRRSFAPGRPAVYMEQVGLLVVTLVALGVGIYVVARFLL* |
Ga0126309_100388142 | 3300010039 | Serpentine Soil | MWKRLRRRTFAPSRPAVFADQIGLLAITLVATAAGIYVVARFLL* |
Ga0126309_100876372 | 3300010039 | Serpentine Soil | MWKRYRRRTFAPSRPALYPDQIGLLLFTLVALAAGIYVVARFLL* |
Ga0126309_101003073 | 3300010039 | Serpentine Soil | VTAIWKRLRRKTMAPSRPALYPDQVGLAIFSLLAIAGGIYAVVRLFIA* |
Ga0126309_101697192 | 3300010039 | Serpentine Soil | MWKRLRRRSLAPGRPAVYPDQIGLLVFTVLALAAGIYWVARFLL* |
Ga0126309_102495532 | 3300010039 | Serpentine Soil | MWKRFRRRTMAPGRPVLYPDQVGLLVFTLLAIGGGIYFVARVVFG* |
Ga0126309_104356792 | 3300010039 | Serpentine Soil | MSWKRLRRRSMAPSRPALYPDQIGLFVFTLAALGGGIYAALRFLL* |
Ga0126309_107914302 | 3300010039 | Serpentine Soil | MWKRLRRRSLAPGRPALYPDQIGLAVFTLAALAAGIYMVARFLL* |
Ga0126308_100496902 | 3300010040 | Serpentine Soil | MWKRLRRRSLAPGRPAVYSDQVGLLVVTLVALAVGIYMVARFLL* |
Ga0126308_101595413 | 3300010040 | Serpentine Soil | MPWKRLRRRSMAPSRPALYPDQIGLFIFTLAALGAGIYAALRYLL* |
Ga0126308_103872612 | 3300010040 | Serpentine Soil | MWRKLRRRTMAPSRPALHPDQIGLLIFTLLAVGGGVYLVVRVAFG* |
Ga0126308_104319471 | 3300010040 | Serpentine Soil | DLMWKRLRRRTMAPSRPALYPDQVGLLVFSLLAIAGGLYVVVRLAFG* |
Ga0126308_112146342 | 3300010040 | Serpentine Soil | RTFAPSRPAVYPDQIGLLVITVVALGAGTYVVFRFLL* |
Ga0126312_100006032 | 3300010041 | Serpentine Soil | MWKRLRRRTMVPSRPAVYPEQVGLLVFSLLAVGGGIYVVVRLAFG* |
Ga0126312_100020933 | 3300010041 | Serpentine Soil | MWKRLRRPTFAPSRPALHQDQIGLLVFVVLALGAGIYFALRFAF* |
Ga0126312_103373703 | 3300010041 | Serpentine Soil | MRRRTFAPSRPAVFPDQIGLLAVTLVAMGVGIYVVARFLL* |
Ga0126314_105617792 | 3300010042 | Serpentine Soil | MAPSRPLLYPDQIGLFAITLIALGAGIYAALRYLL* |
Ga0126314_110163992 | 3300010042 | Serpentine Soil | MWKRLRWRSLAPGRPAVYMEQIGLLAVTLVALAIGIYVVARFLL* |
Ga0126310_100268945 | 3300010044 | Serpentine Soil | MWKRLRRRTLAPSRPAVYPDQIGLLVFTVIALLAGIYVVARFLL* |
Ga0126310_102858432 | 3300010044 | Serpentine Soil | MAPSRPLLYPDQIGLALFTLIALGAGIYAALRYLL* |
Ga0126310_103553583 | 3300010044 | Serpentine Soil | MWKRLRRRTFAPSRPAVFADQIGLLAVTLVAIAAGIYVVARFLL* |
Ga0126310_110830082 | 3300010044 | Serpentine Soil | MWKRFRRRTFAPSRPALYPDQAGLLVITVVAMAVGIYVVARFLV* |
Ga0126311_102666232 | 3300010045 | Serpentine Soil | MWKRLRRGSLAPGRPVIYTEQVGLLVVTVVALAVGIYVMARFLL* |
Ga0126311_103382143 | 3300010045 | Serpentine Soil | MPKKRVPRLLRRTMAPSRPLLYPDQIGLFAITVIALGAGIYAAVRYLL* |
Ga0126311_113056181 | 3300010045 | Serpentine Soil | MWKRLRRRTFTPSRPAVYPDQIGLLLLTVLALGAGTYVVFRFLL* |
Ga0126382_102480442 | 3300010047 | Tropical Forest Soil | RRSLAPSRPAVYPDQVGLLIFSVAAIAGGIYVVFRFLL* |
Ga0126321_12757242 | 3300010145 | Soil | TFAPSRPAVFSDQIGLLIITVGAMAGGIYVVARFLL* |
Ga0126306_100105925 | 3300010166 | Serpentine Soil | MWKRLRRRTFAPSRPAVYADQIGLLAVTLVAMAAGTYVVVRFLL* |
Ga0126306_100422755 | 3300010166 | Serpentine Soil | MWKRLRRRTFAPSRPAVYPDQVGLLLLTVLALGAGTYVVFRFLL* |
Ga0126306_101074624 | 3300010166 | Serpentine Soil | MWKRLRRRTFAPGRPAVYPDQAGLVVFTIAALAGGIYVVVRFLL* |
Ga0134125_127749172 | 3300010371 | Terrestrial Soil | RRRTFAPSRPAVFPDQIGLLVITVAAMAVGIYVVARFLL* |
Ga0134126_113323381 | 3300010396 | Terrestrial Soil | MWKRLRRRTFAPSRPAVYPDQIGLLIVTVLALLAGTYVV |
Ga0134127_111486182 | 3300010399 | Terrestrial Soil | MWKRLRRRTFAPSRPAVYPDQIGLLIFTGVAVAGGIYVVARFLL* |
Ga0134127_114779652 | 3300010399 | Terrestrial Soil | MWKRLRRRTFAPSRPAVFADQIGLLVITLIAMAAGIYVVARFLL* |
Ga0120192_100611892 | 3300012021 | Terrestrial | MWKRLRRRSLAPGRPALYPDQIGLAVITLAALAGGIYVVARFLL* |
Ga0120191_100497952 | 3300012022 | Terrestrial | MWRRLRRRTFAPSRPAVYPDQIGLVAITLVAMGIGTYVVLRFLL* |
Ga0136623_100045313 | 3300012045 | Polar Desert Sand | VEAAARRSFAPGRPAVYDDQVGLVVFVVVALGAGIYFAVKLAI* |
Ga0136621_12753222 | 3300012092 | Polar Desert Sand | MAPSRPLLYPDQIGLALFSLIAIGGGIWAVFEFAL* |
Ga0136632_100121823 | 3300012093 | Polar Desert Sand | VWRRLRRRSFAPGRPAVYDDQVGLVVFVVAALGAGIYFALKLAI* |
Ga0136632_100223134 | 3300012093 | Polar Desert Sand | MWKRLRRRSFAPGRPALYDDQIGLMVFVVAALGVGIYFALKIAI* |
Ga0136619_101112973 | 3300012185 | Polar Desert Sand | FAPGRPALYDDQIGLMVFVVAAPGVGIYFALKIAI* |
Ga0136618_101439662 | 3300012188 | Polar Desert Sand | MWKRLRRRSFAPGRPALYDDQIGLMVFVVTALGVGIYFALKIAI* |
Ga0137364_101308252 | 3300012198 | Vadose Zone Soil | MWKRLRRRTMAPGRPALYPDQVGLLVFSVLAVAGGIYVVVRLAFG* |
Ga0137364_111226782 | 3300012198 | Vadose Zone Soil | MWKRLRRRTFAPSRPALYGDQLGLVLICVLVIAFGIYVVVRVVIG* |
Ga0137374_105230932 | 3300012204 | Vadose Zone Soil | MAPSRPALYPDQIGLFVITLIAIGAGIYAALRYLL* |
Ga0136615_101151844 | 3300012678 | Polar Desert Sand | VWKRLRRRSFAPGRPAVYDDQVGLVVFVVVALGAGIYFALQLAVRLWL |
Ga0136612_100337054 | 3300012680 | Polar Desert Sand | VWKRLRRRSFAPGRPAVYDDQVGLVVFVVVALGAGIYFALKLAI* |
Ga0136612_100488394 | 3300012680 | Polar Desert Sand | MWKRLRRRTMTPSRPALYPDQLGLLLFSLAAIGGGLYAVWRVFTG* |
Ga0136612_102515262 | 3300012680 | Polar Desert Sand | MAPSRPALYPDQAGLLLVCLAAIAGGLYAAARVFFG* |
Ga0157303_101826182 | 3300012896 | Soil | MWKRLRRRTFAPSRPAVYPDQIGLLIFTVVAVAGGIYVVARFLL* |
Ga0157285_101718132 | 3300012897 | Soil | MWKRLRRRTFAPSRPAVYPDQIGLLIFTVLALAVGIYVVARFLL* |
Ga0157296_100492562 | 3300012905 | Soil | MWKRLRRRTFAPSRPAVFADQIGLLAITVIAMAAGIYVVARFLL* |
Ga0157283_102314401 | 3300012907 | Soil | RRRTMSPNRPLLYPDQIGLALFTLIALAVGIFAVVRYLL* |
Ga0157301_101182362 | 3300012911 | Soil | MWKRLRRRTLAPSRPAVFADQIGLLVITVIAMAAGIYVVARFLL* |
Ga0162650_1000729242 | 3300012939 | Soil | MWKRLRRRSLAPGRPALYPDQIGLAFFTVAALVGGIYVVARFLL* |
Ga0164303_112069522 | 3300012957 | Soil | MWKRLRRRTFAPSRPALYPEQVGLLIITLLVIAGGIWAFLKVL* |
Ga0169965_10344502 | 3300013012 | Rock | WKRFRRRTFAPSRPALYSDQIGLAVFVVAAFAAGLFFAVRVFS* |
Ga0170681_10061244 | 3300013026 | Rock | MWKRFRRRTFAPSRPALYSDQIGLAVFVVAAFAAGLFFAVRVFS* |
Ga0163162_125179122 | 3300013306 | Switchgrass Rhizosphere | KCPAMLWKRLRRRTMAPSRPALYPDQIGLFVITLIALGAGIYAAFRYLL* |
Ga0120172_10192683 | 3300013765 | Permafrost | MWKRLRRRTMAPSRPLFYPDQIGLLVFTLIAIGVGAWFVVRLAFG* |
Ga0075324_10481972 | 3300014263 | Natural And Restored Wetlands | MAPSRPALYPDQVGLLVFTLAALGAGIYAAFRYLL* |
Ga0075326_10749631 | 3300014271 | Natural And Restored Wetlands | MAPGRPALYPDQIGLFVFTVAALGGGIYAALRYLL* |
Ga0075310_10862611 | 3300014302 | Natural And Restored Wetlands | KRLRRRTMAPSRPALYPDQIGLFVFTVAALGGGIYAALRYLL* |
Ga0182001_102751952 | 3300014488 | Soil | MWKRLRRRTMAPSRPALYPDEIGLLVITLAAVGGGIYFAVRTFFG* |
Ga0132257_1028550792 | 3300015373 | Arabidopsis Rhizosphere | MAPSRPVLYPDQVGLFVLTVLAVGAGIYAALRFLL* |
Ga0183260_101018574 | 3300017787 | Polar Desert Sand | VWKRLRRRSFAPGRPAVYDDQVGLVVFVVVALGAGVYFALKLAI |
Ga0183260_107496672 | 3300017787 | Polar Desert Sand | MAPSRPILYPDQIGLAFFSLLAVLGGIYAIVKLVS |
Ga0136617_100680213 | 3300017789 | Polar Desert Sand | VWKRLRRRSFAPGRPAVYDDQVGLVVFVVVALGAGIYFALKLAI |
Ga0136617_102105202 | 3300017789 | Polar Desert Sand | MWKRLRRRSFAPGRPALYDDQIGLMVFVVTALGVGIYFALKIAI |
Ga0136617_105599823 | 3300017789 | Polar Desert Sand | MWRRLRRRTMAPHRPILYRDQIGLAVITVVVFAVGIYVVARLVIG |
Ga0136617_106048612 | 3300017789 | Polar Desert Sand | MWKRLRRRSFAPGRPALYDDQIGLMVFVVAALGVGIYFALKIAI |
Ga0184608_104126781 | 3300018028 | Groundwater Sediment | RRSFAPGRPAVYMEQVGLLVITLVALAVGIYVVARFLL |
Ga0184619_101647851 | 3300018061 | Groundwater Sediment | MAPSRPALYPDQVGLLIFTLAALGGGIWAVAHFVF |
Ga0184619_103986012 | 3300018061 | Groundwater Sediment | RRRSMAPSRPALYPDQIGLFVITLIALGAGIYAALRYLL |
Ga0184619_105069501 | 3300018061 | Groundwater Sediment | MWKRLRRRSLAPGRPALYPDQVGLAVFTLAALVGGIYVVARFLL |
Ga0184624_101214603 | 3300018073 | Groundwater Sediment | MPWKRLRRRTMAPSRPALYPDQIGLFVLTLAAIGGGIYAALRYLL |
Ga0190265_1000326310 | 3300018422 | Soil | MWKRLRRRTFAPSRPAVYMEQIGLLVITLFALAVGIYVVARFLL |
Ga0190265_100347566 | 3300018422 | Soil | MWKRLRRRTMAPGRPALYPDQVGLALFSLVAVAGGIYAVARFLL |
Ga0190265_104029812 | 3300018422 | Soil | MWKRLRRRTFAPSRPALYPDQVGLAIFVLLALAAGIYVVARFLL |
Ga0190265_111459433 | 3300018422 | Soil | MWRKLRRRTMAPSRPAVYPDQIGLVVFTVLALAVGIYAAVRWLL |
Ga0190265_115476241 | 3300018422 | Soil | KRLRRRSFAPGRPAVYMEQVGLLVVTLVALAGGIYVVARFLL |
Ga0190265_131365982 | 3300018422 | Soil | MWKRLRRRPFAPGRPAVHEDQIGLLLFVIVGLGVGIYFALRFAT |
Ga0190272_103228734 | 3300018429 | Soil | MAPSRPALYPDQVGLLAITLVALGAGIYVVFRFLL |
Ga0190272_107611842 | 3300018429 | Soil | MWKRFRRRTMAPGRPALYPDQVGLALFSLVAVAGGIYAVARFLL |
Ga0190272_112064422 | 3300018429 | Soil | MWKRLRRKTFAPGRPAVYPDQVGLVIFTAAALIAGTYVVARFLL |
Ga0190275_105337973 | 3300018432 | Soil | MWKRLRRRTFGPSRPALYDDQYGLLFFVLLALGVGIYFAFKFAL |
Ga0190275_108911442 | 3300018432 | Soil | MWKRLRRRTFAPGRPAVHEDQIGLLLFVIVALGVGIYCALRFAT |
Ga0190275_111465282 | 3300018432 | Soil | MWKRFRRRTFAPSRPALYPDQIGFAVFTVAALAAGIYVVARFLL |
Ga0190275_114524942 | 3300018432 | Soil | MWKRLRRRTFAPSRPALFPDQIGLVLIVLLALGVGIFFAVRVVV |
Ga0190275_116121172 | 3300018432 | Soil | MWKRLRRLQRRTMAPSRPVVYPDQIGLVFFTLVVFAVGAYVIVRLVIG |
Ga0190275_122424192 | 3300018432 | Soil | MWKRVRRRSFAPGRPAVYVEQVGLLAVTLVALAVGIYVVARFLL |
Ga0190269_104830222 | 3300018465 | Soil | MLWKRLRRRSLAPGRPALYPDQIGLAVFTVAALVGGIYVVVRFLL |
Ga0190269_108008662 | 3300018465 | Soil | RMWKRLRRRTFAPSRLAVYPDQVGLLFFTVIALIVGIYVVVRFLL |
Ga0190268_103406282 | 3300018466 | Soil | MPWKRLRRRTMAPSRPVLYPDQIGLLVFTLAAIGGGIYAALRYLL |
Ga0190268_116489542 | 3300018466 | Soil | MLWKRLRRRSLAPGRPALYPDQIGLAFFTVVALVGGIYVVVRFLL |
Ga0190268_116620242 | 3300018466 | Soil | MWKRLRRRSLAPGRPAVYMEQVGLLVVTLAALAGGIYVVVRFLL |
Ga0190270_100650064 | 3300018469 | Soil | MPWKRLRRRTMAPSRPALYPDQIGLLVFTVAAIGGGIYAALRYLL |
Ga0190270_109219141 | 3300018469 | Soil | MWKRLRRRTFAPSRPAVREDQIGLVLFIVVALGVGFYFALRFAI |
Ga0190270_112009522 | 3300018469 | Soil | MWRKLRRRTMAPSRPAVYPDQIGLVVFTVLALGVGIYAAVRWLL |
Ga0190270_115621672 | 3300018469 | Soil | MWKRLRRRTFAPGRPALYEDQIGLAVFVVVAFAVGIYFALRFAI |
Ga0190270_134255282 | 3300018469 | Soil | MWKRLRRRSLAPGRPALYPDQIGLAFFTVAALVGGIYVVARFLL |
Ga0190274_103832072 | 3300018476 | Soil | MAPSRPALYPDQIGLLVFTVAAIGGGIYAALRYLL |
Ga0190274_126460461 | 3300018476 | Soil | LRRRTLAPGRPAVYPDQAGLLVITLVALAVGIYVVVRFLL |
Ga0173481_103320812 | 3300019356 | Soil | MWKRLRRRTFAPGRPAVFPDQIGLLVITVVAMAAGIYVVARFLL |
Ga0173481_105648691 | 3300019356 | Soil | MWKRLRRRTFAPSRPAVYPDQIGLLMFTVVAVAGGIYVVARFLL |
Ga0190264_111075482 | 3300019377 | Soil | MWKRLRRRTFAPGRPAVYPDQAGLLIFTIAALAAGIFVVVRFLL |
Ga0190264_112270782 | 3300019377 | Soil | MWKRLRRRTFAPSRPALYPDQVGLVTFTVLALAVGIYVVARFLL |
Ga0190267_114957952 | 3300019767 | Soil | MWKRLRRRTFAPSRPAVYPDQVGLLFFILIAMAVGIYVVVRFLL |
Ga0193748_10012641 | 3300019865 | Soil | MWKRLRRRTFAPSRPALYPDQVGLLIFTVVALAVGIYVVARFLL |
Ga0193741_10478262 | 3300019884 | Soil | MLWKRLRRRSLAPGRPALYPDQIGLAFFTVVALAGGIYVVVRFLL |
Ga0196959_101108012 | 3300021184 | Soil | TFAPSRPALYPDQIGLAIFTVLALAAGIYVVLRFLL |
Ga0193706_10043727 | 3300021339 | Soil | MWKRLRRRTFAPRRPAVYMEQVGLLVVTLVALAVGIYVVVRFLL |
Ga0222622_107222031 | 3300022756 | Groundwater Sediment | MWKRLRRRTFAPGRPAVYPDQIGVLVISVVAMAAGIYV |
Ga0210115_10190352 | 3300025791 | Natural And Restored Wetlands | MAPSRPALYPDQIGLFVFTVAALGGGIYAALRYLL |
Ga0207657_112073822 | 3300025919 | Corn Rhizosphere | RRTFAPSRPAVFPDQIGLLVITLVAMAAGIYVVARFLL |
Ga0207686_104504612 | 3300025934 | Miscanthus Rhizosphere | MWKRLRRRTFAPSRPAVYPDQIGLLIVTVLALLAGTYVVLRFLL |
Ga0207669_111667552 | 3300025937 | Miscanthus Rhizosphere | VLPMFDRLRRRTMSPGRPLLYPDQIGLALFTLIALAVGIFAVVRYLL |
Ga0207661_109480552 | 3300025944 | Corn Rhizosphere | MWKRLRRRTFAPSRPAVYPDQIGLLIFTGVAVAGGIYVVARFLL |
Ga0207679_115792112 | 3300025945 | Corn Rhizosphere | MWKRLRRRTFAPSRPALFPDQIGLLVITLLAMGAGIYVVARFLL |
Ga0207667_121090672 | 3300025949 | Corn Rhizosphere | RRRTFAPSRPAVFPDQIGLLVITLGAMAAGIYVVARFLL |
Ga0207708_108075332 | 3300026075 | Corn, Switchgrass And Miscanthus Rhizosphere | MWKRLRRRTFAPSRPAVYPDQIGLLIVTVLALLAGTYVVVRFLL |
Ga0207675_1015739551 | 3300026118 | Switchgrass Rhizosphere | MAPSRPVLYPDQVGLFVLTVLALGAGIYAALRFLL |
Ga0208612_10016625 | 3300027638 | Polar Desert | VWKRLRRRSFAPGRPAVYDDQVGLVVFVVVALGAGIYFAVKLAI |
Ga0209485_10226882 | 3300027691 | Agricultural Soil | RRTFAPSRPAVFPDQIGLLVFTLVAMAVGIYVVARFLL |
Ga0209814_102385941 | 3300027873 | Populus Rhizosphere | MWKRLRRRTFAPSRPAVYPDQIGLLFFTVIALIAGIYVVVRFLL |
Ga0207428_104812602 | 3300027907 | Populus Rhizosphere | MWKRLRRRTFAPSRPALYPDQIGLLIFTVAALAGGIYVVARYLL |
Ga0209382_100862802 | 3300027909 | Populus Rhizosphere | MWKRLRRRSLAPGRPAVYPDQIGLLVFTLAALAGGIYVVVRFLL |
Ga0209382_104358612 | 3300027909 | Populus Rhizosphere | MAPSRPALYPDQIGLFVFTVAALGAGIYAALRYLL |
Ga0209382_116553162 | 3300027909 | Populus Rhizosphere | MWKRLRRRTFAPSRPAVYPDQVGLLFFTAIALIVGIYVVARFLL |
Ga0247818_102549274 | 3300028589 | Soil | MPWKNLRRRTMAPSRPALYPDQVGLFVLTVLALGAGIYAALRFLL |
Ga0307321_10624981 | 3300028704 | Soil | MWKRLRRRTFAPGRPAVYPDQIGLLVISVVAMAAGIYVVARF |
Ga0307276_100042234 | 3300028705 | Soil | MWNRLRRRTFAPSRPAVYPDQIGLLIFTVVALVAGIYVVARFLL |
Ga0307276_100545642 | 3300028705 | Soil | MAPSRPLLYPDQIGLALFTLIALGAGIYAALRYLL |
Ga0307276_101065942 | 3300028705 | Soil | SPVQSGAMWKRFRRRTMAPSRPALYPDQIGLLVFTLLAIGGGVYFIVRVVFG |
Ga0307291_11715352 | 3300028707 | Soil | MLWKRLRRRTMAPSRPALYPDQIGLFVITLIALGAGIYAAFRYLL |
Ga0307303_100850162 | 3300028713 | Soil | MWKRLRRRTFAPSRPAVYPDQIGLLIFTVVALLAGIYVVARFLL |
Ga0307309_101654121 | 3300028714 | Soil | MWKRLRRRTFAPSRPALYPDQVGLLIFTVVALAVGIYVVARFL |
Ga0307315_100349952 | 3300028721 | Soil | MWKRLRRRTFAPSRPALFPDQIGLLAITLVAMAAGIYVVARFLL |
Ga0307318_102187082 | 3300028744 | Soil | MWKRLRRRTFAPSRPALYEDQIGLLVIVVVALGVGIWFALRAFL |
Ga0307316_101827603 | 3300028755 | Soil | MWKRLRRRTFAPSRPAVYPDQVGLLIFTLIALLAGIYVVVRFLL |
Ga0307302_104335812 | 3300028814 | Soil | RRRTMAPSRPALYPDQIGLFVLTVLALGAGIYAALRFLL |
Ga0307286_102140272 | 3300028876 | Soil | MAPSRPVLYPDQIGLFVLTVAALAGGIYAAVRYLL |
Ga0307278_103942962 | 3300028878 | Soil | MWKRLRRRTFAPSRPALYPDQIGLLVVSVVAMAAGIYVVARFLL |
Ga0307300_100655673 | 3300028880 | Soil | MWKRLRRRTMAPSRPALYPDQVGLLIFTLLAIGGGVYFLVRVVFG |
Ga0247827_100458011 | 3300028889 | Soil | RTFAPSRPALYPDQIGLLIFTVAALAGGIYVVARYLL |
Ga0299907_100266812 | 3300030006 | Soil | MWRKLRRRTMAPSRPAVYPDQIGLVVFTVLALSVGIYAAVRWLL |
Ga0299907_113548262 | 3300030006 | Soil | MWKRLRRRSMSPSRPAIYPDQVGLLLFTLLAIGVGVYFAV |
Ga0247826_101550871 | 3300030336 | Soil | KRLRRRTFAPSRPALYPDQIGLLIFTVAALAGGIYVVARYLL |
Ga0247826_101864382 | 3300030336 | Soil | MPWKRLRRRTMAPSRPALYPDQIGLFVLTVAALAGGIYAALRYLL |
Ga0247826_103862602 | 3300030336 | Soil | MAPSRPVLYPDQVGLFVLTVLAVGAGIYAALRFLL |
Ga0268241_100918981 | 3300030511 | Soil | MWRRLRRRTLAPSRPAVYPDQIGLLVVTVIALAAGTYVVFRFLL |
Ga0307501_101988862 | 3300031152 | Soil | MWKRLRRRTMAPSRPALYPDQVGLLVFSLLAVGGGIYVVVRLAFG |
Ga0307501_102644862 | 3300031152 | Soil | MLWKRLRRRTMAPSRPALYPDQIGLFVISLIALGAGIYAA |
Ga0307501_102720351 | 3300031152 | Soil | MWKRLRRRTFAPGRPAVYMEQVGLLVVTLAALAAGIYVVARF |
Ga0307497_103371932 | 3300031226 | Soil | SKSPAMLWKRLRRRTMAPSRPALYPDQIGLFVITLIALGAGIYAAFRYLL |
Ga0299913_102118882 | 3300031229 | Soil | MWKRLRRRTMAPSRPALYPDQVGLLLFSLLAIGGGIYAVARFLL |
Ga0299913_104496562 | 3300031229 | Soil | MWKRLRRRTMAPGRPALHPDQVGLALFSLLALAGGIYAVARLLL |
Ga0299913_105735672 | 3300031229 | Soil | MWKRLRRRTMAPGRPALYPDQVGLALFSLLALAGGIYAVARLLL |
Ga0299913_112404861 | 3300031229 | Soil | MWKRFRRRTMAPGRPALYPDQVGLALFSLLALAGGIYAVARLLL |
Ga0307408_1002091913 | 3300031548 | Rhizosphere | MAPSRPALYPDQIGLLVFTVAALAGGIYAALRYLL |
Ga0307405_102226342 | 3300031731 | Rhizosphere | MAPSRPVLYPDQIGLFVFTVAAIGGGIYAALRYLL |
Ga0307406_109437082 | 3300031901 | Rhizosphere | MPWKRLRRRTMAPSRPVLYPDQIGLLIFTLAALGAGIYAAFRYLL |
Ga0308175_1032741352 | 3300031938 | Soil | MWKRLRRRTFAPSRPAVYPDQIGLLIFTLIALLAGIYVVVRFLV |
Ga0307409_1003474732 | 3300031995 | Rhizosphere | MWKRLRRRTFAPGRPAVHPDQVGLVVFTIAALAGGIYVVVRFLL |
Ga0307409_1004769731 | 3300031995 | Rhizosphere | MWKRLRRRTFAPSRPAVFADQIGLLAITLVAMAAGIYVVARFLL |
Ga0307411_101449482 | 3300032005 | Rhizosphere | MAPSRPVLYPDQIGLFVFTVAALAGGIYAALRYLL |
Ga0310890_104533122 | 3300032075 | Soil | LRRRTFAPSRPALYPDQIGLLIFTVAALAGGIYVVARYLL |
Ga0326721_106502722 | 3300032080 | Soil | MAPSRPALYPDQIGLFVFTVGALGGGIYAAFRYLL |
Ga0307415_1024887581 | 3300032126 | Rhizosphere | MAPSRPALYPDQIGLLIFTLAALGAGIYAAFRFLL |
Ga0334947_107573_292_402 | 3300034251 | Sub-Biocrust Soil | MAPRRPAVFPEQIGLVIFIAVAMAVGIYFVLRVALA |
⦗Top⦘ |