Scaffold Ga0310130_0144384

Overview

Basic Information

• Taxon OID: 3300034073
• Scaffold ID: Ga0310130_0144384
• Source Dataset Name: Fracking water microbial communities from deep shales in Oklahoma, United States - MC-6-XL
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 727
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (66.67%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae → unclassified Kyanoviridae → Synechococcus phage S-SRM01 (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Fracking Water → Subsurface Microbial Communities From Deep Shales In Ohio And West Virginia, Usa

Source Dataset Sampling Location

• Location Name: USA: Oklahoma
• Coordinates
  • Lat. (^o): 35.784
  • Long. (^o): -98.26
  • Depth (m): 2896

Associated Families

Family	Category	Number of Sequences	3D Structure?
F058099	Metagenome / Metatranscriptome	135	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0310130_0144384_328_474	F058099	GGAGG	MTKQLLISQLRQGQNGNDILHILDVLCNGMDSSESSQDNVPTLDEIQF