| Basic Information | |
|---|---|
| Family ID | F058099 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 135 |
| Average Sequence Length | 47 residues |
| Representative Sequence | MTKQLLINQLRLGKNGNDILHILDALCDGMDSSESSQDNVPTLDEIQF |
| Number of Associated Samples | 95 |
| Number of Associated Scaffolds | 135 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Viruses |
| % of genes with valid RBS motifs | 33.33 % |
| % of genes near scaffold ends (potentially truncated) | 22.96 % |
| % of genes from short scaffolds (< 2000 bps) | 57.04 % |
| Associated GOLD sequencing projects | 84 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.48 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Predicted Viral (45.185 % of family members) |
| NCBI Taxonomy ID | 10239 (predicted) |
| Taxonomy | All Organisms → Viruses → Predicted Viral |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous (20.741 % of family members) |
| Environment Ontology (ENVO) | Unclassified (34.815 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) (37.778 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 36.84% β-sheet: 0.00% Coil/Unstructured: 63.16% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.48 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 135 Family Scaffolds |
|---|---|---|
| PF13392 | HNH_3 | 2.22 |
| PF12098 | DUF3574 | 0.74 |
| PF00805 | Pentapeptide | 0.74 |
| PF03330 | DPBB_1 | 0.74 |
| PF16075 | DUF4815 | 0.74 |
| PF01555 | N6_N4_Mtase | 0.74 |
| PF02675 | AdoMet_dc | 0.74 |
| PF13385 | Laminin_G_3 | 0.74 |
| PF02672 | CP12 | 0.74 |
| PF13508 | Acetyltransf_7 | 0.74 |
| COG ID | Name | Functional Category | % Frequency in 135 Family Scaffolds |
|---|---|---|---|
| COG0863 | DNA modification methylase | Replication, recombination and repair [L] | 0.74 |
| COG1041 | tRNA G10 N-methylase Trm11 | Translation, ribosomal structure and biogenesis [J] | 0.74 |
| COG1357 | Uncharacterized conserved protein YjbI, contains pentapeptide repeats | Function unknown [S] | 0.74 |
| COG1586 | S-adenosylmethionine decarboxylase | Amino acid transport and metabolism [E] | 0.74 |
| COG2189 | Adenine specific DNA methylase Mod | Replication, recombination and repair [L] | 0.74 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 77.04 % |
| Unclassified | root | N/A | 22.96 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300001968|GOS2236_1056619 | All Organisms → Viruses → Predicted Viral | 4481 | Open in IMG/M |
| 3300002476|metazooDRAFT_10761007 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae → unclassified Kyanoviridae → Synechococcus phage S-SRM01 | 537 | Open in IMG/M |
| 3300002835|B570J40625_100025147 | Not Available | 9740 | Open in IMG/M |
| 3300002835|B570J40625_100097450 | Not Available | 3656 | Open in IMG/M |
| 3300002835|B570J40625_101055601 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae → unclassified Kyanoviridae → Synechococcus phage S-SRM01 | 690 | Open in IMG/M |
| 3300003430|JGI25921J50272_10004487 | All Organisms → Viruses → Predicted Viral | 4421 | Open in IMG/M |
| 3300004096|Ga0066177_10013047 | All Organisms → Viruses → Predicted Viral | 2555 | Open in IMG/M |
| 3300004126|Ga0066179_10156101 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae → unclassified Kyanoviridae → Synechococcus phage S-SRM01 | 619 | Open in IMG/M |
| 3300004481|Ga0069718_14544101 | All Organisms → Viruses → Predicted Viral | 3627 | Open in IMG/M |
| 3300004787|Ga0007755_1591005 | All Organisms → Viruses → Predicted Viral | 1866 | Open in IMG/M |
| 3300004795|Ga0007756_11565684 | All Organisms → Viruses → Predicted Viral | 1049 | Open in IMG/M |
| 3300005528|Ga0068872_10003825 | Not Available | 11426 | Open in IMG/M |
| 3300005805|Ga0079957_1018861 | All Organisms → Viruses → Predicted Viral | 4884 | Open in IMG/M |
| 3300005805|Ga0079957_1019568 | All Organisms → Viruses → Predicted Viral | 4771 | Open in IMG/M |
| 3300005805|Ga0079957_1062464 | All Organisms → Viruses → Predicted Viral | 2201 | Open in IMG/M |
| 3300006025|Ga0075474_10003256 | Not Available | 6774 | Open in IMG/M |
| 3300006030|Ga0075470_10000033 | Not Available | 49898 | Open in IMG/M |
| 3300006033|Ga0075012_10011701 | Not Available | 7676 | Open in IMG/M |
| 3300006639|Ga0079301_1025434 | All Organisms → Viruses → Predicted Viral | 2031 | Open in IMG/M |
| 3300006639|Ga0079301_1027311 | All Organisms → Viruses → Predicted Viral | 1945 | Open in IMG/M |
| 3300006641|Ga0075471_10000103 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 40144 | Open in IMG/M |
| 3300006810|Ga0070754_10077745 | All Organisms → Viruses → Predicted Viral | 1680 | Open in IMG/M |
| 3300007165|Ga0079302_1004679 | All Organisms → Viruses → Predicted Viral | 3803 | Open in IMG/M |
| 3300007169|Ga0102976_1114451 | All Organisms → Viruses → Predicted Viral | 2476 | Open in IMG/M |
| 3300007202|Ga0103274_1212347 | All Organisms → Viruses → Predicted Viral | 1128 | Open in IMG/M |
| 3300007216|Ga0103961_1049069 | All Organisms → Viruses → Predicted Viral | 1564 | Open in IMG/M |
| 3300007538|Ga0099851_1018641 | All Organisms → Viruses → Predicted Viral | 2811 | Open in IMG/M |
| 3300007538|Ga0099851_1205959 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae → unclassified Kyanoviridae → Synechococcus phage S-SRM01 | 714 | Open in IMG/M |
| 3300007539|Ga0099849_1121817 | All Organisms → Viruses → Predicted Viral | 1026 | Open in IMG/M |
| 3300007541|Ga0099848_1023410 | All Organisms → Viruses → Predicted Viral | 2618 | Open in IMG/M |
| 3300007541|Ga0099848_1047275 | All Organisms → Viruses → Predicted Viral | 1743 | Open in IMG/M |
| 3300007541|Ga0099848_1129917 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae → unclassified Kyanoviridae → Synechococcus phage S-SRM01 | 946 | Open in IMG/M |
| 3300007541|Ga0099848_1336522 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae → unclassified Kyanoviridae → Synechococcus phage S-SRM01 | 511 | Open in IMG/M |
| 3300007542|Ga0099846_1061168 | All Organisms → Viruses → Predicted Viral | 1417 | Open in IMG/M |
| 3300007542|Ga0099846_1270149 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae → unclassified Kyanoviridae → Synechococcus phage S-SRM01 | 587 | Open in IMG/M |
| 3300007542|Ga0099846_1302232 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae → unclassified Kyanoviridae → Synechococcus phage S-SRM01 | 548 | Open in IMG/M |
| 3300007960|Ga0099850_1386665 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae → unclassified Kyanoviridae → Synechococcus phage S-SRM01 | 520 | Open in IMG/M |
| 3300008012|Ga0075480_10129636 | All Organisms → Viruses → Predicted Viral | 1386 | Open in IMG/M |
| 3300009056|Ga0102860_1157058 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae → unclassified Kyanoviridae → Synechococcus phage S-SRM01 | 644 | Open in IMG/M |
| 3300009075|Ga0105090_10524108 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae → unclassified Kyanoviridae → Synechococcus phage S-SRM01 | 720 | Open in IMG/M |
| 3300009085|Ga0105103_10359910 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae → unclassified Kyanoviridae → Synechococcus phage S-SRM01 | 801 | Open in IMG/M |
| 3300009124|Ga0118687_10003814 | Not Available | 5267 | Open in IMG/M |
| 3300009165|Ga0105102_10000718 | Not Available | 10281 | Open in IMG/M |
| 3300009235|Ga0103857_10056349 | Not Available | 753 | Open in IMG/M |
| 3300010299|Ga0129342_1165909 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae → unclassified Kyanoviridae → Synechococcus phage S-SRM01 | 798 | Open in IMG/M |
| 3300010354|Ga0129333_10006168 | Not Available | 11336 | Open in IMG/M |
| 3300010354|Ga0129333_10037798 | All Organisms → Viruses → Predicted Viral | 4555 | Open in IMG/M |
| 3300010354|Ga0129333_10061162 | All Organisms → Viruses → Predicted Viral | 3511 | Open in IMG/M |
| 3300010354|Ga0129333_10078228 | All Organisms → Viruses → Predicted Viral | 3069 | Open in IMG/M |
| 3300010354|Ga0129333_10155263 | All Organisms → Viruses → Predicted Viral | 2099 | Open in IMG/M |
| 3300010354|Ga0129333_10451370 | All Organisms → Viruses → Predicted Viral | 1132 | Open in IMG/M |
| 3300010354|Ga0129333_10802699 | Not Available | 802 | Open in IMG/M |
| 3300010354|Ga0129333_11012995 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae → unclassified Kyanoviridae → Synechococcus phage S-SRM01 | 697 | Open in IMG/M |
| 3300010354|Ga0129333_11355264 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae → unclassified Kyanoviridae → Synechococcus phage S-SRM01 | 586 | Open in IMG/M |
| 3300010354|Ga0129333_11445639 | Not Available | 564 | Open in IMG/M |
| 3300010370|Ga0129336_10167423 | All Organisms → Viruses → Predicted Viral | 1263 | Open in IMG/M |
| 3300010370|Ga0129336_10167661 | All Organisms → Viruses → Predicted Viral | 1262 | Open in IMG/M |
| 3300010370|Ga0129336_10244449 | All Organisms → Viruses → Predicted Viral | 1010 | Open in IMG/M |
| 3300010370|Ga0129336_10457970 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae → unclassified Kyanoviridae → Synechococcus phage S-SRM01 | 691 | Open in IMG/M |
| 3300010370|Ga0129336_10521062 | Not Available | 639 | Open in IMG/M |
| 3300010370|Ga0129336_10651384 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae → unclassified Kyanoviridae → Synechococcus phage S-SRM01 | 560 | Open in IMG/M |
| 3300011984|Ga0119931_1005277 | All Organisms → Viruses → Predicted Viral | 1407 | Open in IMG/M |
| 3300012000|Ga0119951_1006650 | Not Available | 5277 | Open in IMG/M |
| 3300013087|Ga0163212_1046568 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae → unclassified Kyanoviridae → Synechococcus phage S-SRM01 | 1469 | Open in IMG/M |
| 3300016681|Ga0180043_124913 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae → unclassified Kyanoviridae → Synechococcus phage S-SRM01 | 528 | Open in IMG/M |
| 3300020074|Ga0194113_10084089 | Not Available | 2863 | Open in IMG/M |
| 3300020109|Ga0194112_10400562 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae → unclassified Kyanoviridae → Synechococcus phage S-SRM01 | 993 | Open in IMG/M |
| 3300020109|Ga0194112_10773460 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae → Haifavirus → Haifavirus tim68 | 631 | Open in IMG/M |
| 3300020151|Ga0211736_10558153 | All Organisms → Viruses → Predicted Viral | 4751 | Open in IMG/M |
| 3300020159|Ga0211734_10986972 | All Organisms → Viruses → Predicted Viral | 2927 | Open in IMG/M |
| 3300020161|Ga0211726_10609874 | All Organisms → Viruses → Predicted Viral | 4389 | Open in IMG/M |
| 3300020183|Ga0194115_10068638 | All Organisms → Viruses → Predicted Viral | 2117 | Open in IMG/M |
| 3300020498|Ga0208050_1000719 | All Organisms → Viruses → Predicted Viral | 4994 | Open in IMG/M |
| 3300020498|Ga0208050_1009634 | All Organisms → Viruses → Predicted Viral | 1100 | Open in IMG/M |
| 3300020530|Ga0208235_1002141 | All Organisms → Viruses → Predicted Viral | 3201 | Open in IMG/M |
| 3300020551|Ga0208360_1020712 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae → unclassified Kyanoviridae → Synechococcus phage S-SRM01 | 879 | Open in IMG/M |
| 3300021091|Ga0194133_10003101 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 24200 | Open in IMG/M |
| 3300021961|Ga0222714_10019476 | Not Available | 5358 | Open in IMG/M |
| 3300021961|Ga0222714_10022843 | All Organisms → Viruses → Predicted Viral | 4836 | Open in IMG/M |
| 3300021964|Ga0222719_10053344 | All Organisms → Viruses → Predicted Viral | 3072 | Open in IMG/M |
| 3300022067|Ga0196895_1001280 | All Organisms → Viruses → Predicted Viral | 2610 | Open in IMG/M |
| 3300022198|Ga0196905_1043590 | All Organisms → Viruses → Predicted Viral | 1299 | Open in IMG/M |
| 3300022198|Ga0196905_1193119 | Not Available | 512 | Open in IMG/M |
| 3300022200|Ga0196901_1061116 | All Organisms → Viruses → Predicted Viral | 1383 | Open in IMG/M |
| 3300022200|Ga0196901_1061838 | All Organisms → Viruses → Predicted Viral | 1373 | Open in IMG/M |
| 3300022200|Ga0196901_1066819 | All Organisms → Viruses → Predicted Viral | 1308 | Open in IMG/M |
| 3300022747|Ga0228703_1008378 | All Organisms → Viruses → Predicted Viral | 4106 | Open in IMG/M |
| 3300022748|Ga0228702_1021374 | All Organisms → Viruses → Predicted Viral | 2122 | Open in IMG/M |
| 3300022752|Ga0214917_10003976 | Not Available | 16757 | Open in IMG/M |
| 3300022752|Ga0214917_10145534 | All Organisms → Viruses → Predicted Viral | 1264 | Open in IMG/M |
| 3300022752|Ga0214917_10193555 | All Organisms → Viruses → Predicted Viral | 1012 | Open in IMG/M |
| 3300024239|Ga0247724_1062327 | Not Available | 562 | Open in IMG/M |
| 3300024289|Ga0255147_1000501 | Not Available | 10928 | Open in IMG/M |
| 3300024354|Ga0255171_1055015 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae → unclassified Kyanoviridae → Synechococcus phage S-SRM01 | 743 | Open in IMG/M |
| 3300024515|Ga0255183_1086381 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae → unclassified Kyanoviridae → Synechococcus phage S-SRM01 | 631 | Open in IMG/M |
| 3300025283|Ga0208048_1013413 | All Organisms → Viruses → Predicted Viral | 2747 | Open in IMG/M |
| 3300025585|Ga0208546_1000023 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 87156 | Open in IMG/M |
| 3300025646|Ga0208161_1139696 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae → Bellamyvirus → unclassified Bellamyvirus → Synechococcus phage SynMITS9220M01 | 618 | Open in IMG/M |
| 3300025646|Ga0208161_1171683 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae → unclassified Kyanoviridae → Synechococcus phage S-SRM01 | 521 | Open in IMG/M |
| 3300025647|Ga0208160_1021041 | All Organisms → Viruses → Predicted Viral | 2064 | Open in IMG/M |
| 3300025674|Ga0208162_1005926 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 5584 | Open in IMG/M |
| 3300025732|Ga0208784_1000194 | Not Available | 32077 | Open in IMG/M |
| 3300026473|Ga0255166_1038005 | Not Available | 979 | Open in IMG/M |
| 3300027114|Ga0208009_1001824 | Not Available | 5966 | Open in IMG/M |
| 3300027121|Ga0255074_1018199 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae → unclassified Kyanoviridae → Synechococcus phage S-SRM01 | 901 | Open in IMG/M |
| 3300027499|Ga0208788_1063259 | Not Available | 951 | Open in IMG/M |
| 3300027683|Ga0209392_1166883 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae → unclassified Kyanoviridae → Synechococcus phage S-SRM01 | 680 | Open in IMG/M |
| 3300027693|Ga0209704_1188178 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae → unclassified Kyanoviridae → Synechococcus phage S-SRM01 | 601 | Open in IMG/M |
| 3300027697|Ga0209033_1066720 | All Organisms → Viruses → Predicted Viral | 1246 | Open in IMG/M |
| (restricted) 3300027730|Ga0247833_1052074 | All Organisms → Viruses → Predicted Viral | 2192 | Open in IMG/M |
| 3300027793|Ga0209972_10007229 | Not Available | 7846 | Open in IMG/M |
| 3300027804|Ga0209358_10031190 | All Organisms → Viruses → Predicted Viral | 3272 | Open in IMG/M |
| 3300029930|Ga0119944_1000281 | Not Available | 8810 | Open in IMG/M |
| 3300029933|Ga0119945_1011636 | All Organisms → Viruses → Predicted Viral | 1135 | Open in IMG/M |
| 3300031999|Ga0315274_10861219 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae → unclassified Kyanoviridae → Synechococcus phage S-SRM01 | 950 | Open in IMG/M |
| 3300032053|Ga0315284_11149356 | Not Available | 858 | Open in IMG/M |
| 3300033521|Ga0316616_100790161 | All Organisms → Viruses → Predicted Viral | 1153 | Open in IMG/M |
| 3300033521|Ga0316616_104162516 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae → unclassified Kyanoviridae → Synechococcus phage S-SRM01 | 544 | Open in IMG/M |
| 3300033557|Ga0316617_100372613 | All Organisms → Viruses → Predicted Viral | 1246 | Open in IMG/M |
| 3300033816|Ga0334980_0006339 | Not Available | 5263 | Open in IMG/M |
| 3300033816|Ga0334980_0031009 | All Organisms → Viruses → Predicted Viral | 2280 | Open in IMG/M |
| 3300033816|Ga0334980_0088469 | All Organisms → Viruses → Predicted Viral | 1291 | Open in IMG/M |
| 3300033816|Ga0334980_0109055 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae → unclassified Kyanoviridae → Synechococcus phage S-SRM01 | 1148 | Open in IMG/M |
| 3300033978|Ga0334977_0297445 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae → unclassified Kyanoviridae → Synechococcus phage S-SRM01 | 777 | Open in IMG/M |
| 3300033994|Ga0334996_0440615 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae → unclassified Kyanoviridae → Synechococcus phage S-SRM01 | 600 | Open in IMG/M |
| 3300034012|Ga0334986_0331587 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae → unclassified Kyanoviridae → Synechococcus phage S-SRM01 | 796 | Open in IMG/M |
| 3300034061|Ga0334987_0008684 | Not Available | 9559 | Open in IMG/M |
| 3300034061|Ga0334987_0506077 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae → unclassified Kyanoviridae → Synechococcus phage S-SRM01 | 735 | Open in IMG/M |
| 3300034061|Ga0334987_0821920 | Not Available | 515 | Open in IMG/M |
| 3300034072|Ga0310127_088911 | All Organisms → Viruses → Predicted Viral | 1367 | Open in IMG/M |
| 3300034073|Ga0310130_0144384 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae → unclassified Kyanoviridae → Synechococcus phage S-SRM01 | 727 | Open in IMG/M |
| 3300034096|Ga0335025_0616620 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae → unclassified Kyanoviridae → Synechococcus phage S-SRM01 | 533 | Open in IMG/M |
| 3300034101|Ga0335027_0029474 | All Organisms → Viruses → Predicted Viral | 4597 | Open in IMG/M |
| 3300034104|Ga0335031_0835786 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae → unclassified Kyanoviridae → Synechococcus phage S-SRM01 | 511 | Open in IMG/M |
| 3300034283|Ga0335007_0029368 | Not Available | 4321 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 20.74% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 15.56% |
| Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 12.59% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 6.67% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 5.93% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 5.19% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 3.70% |
| Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 3.70% |
| Deep Subsurface | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface | 3.70% |
| Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Lake | 2.22% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 2.22% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 2.22% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 2.96% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 1.48% |
| Aquatic | Environmental → Aquatic → Freshwater → Drinking Water → Unclassified → Aquatic | 1.48% |
| Freshwater | Environmental → Aquatic → Freshwater → Creek → Unclassified → Freshwater | 1.48% |
| Fracking Water | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Fracking Water | 1.48% |
| Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Sediment | 0.74% |
| Lake | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Lake | 0.74% |
| Drinking Water Treatment Plant | Environmental → Aquatic → Freshwater → Drinking Water → Unclassified → Drinking Water Treatment Plant | 0.74% |
| Watersheds | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Watersheds | 0.74% |
| River Water | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → River Water | 0.74% |
| Marine | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine | 0.74% |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 0.74% |
| Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment | 0.74% |
| Deep Subsurface Sediment | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface Sediment | 0.74% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300001968 | Marine microbial communities from Lake Gatun, Panama - GS020 | Environmental | Open in IMG/M |
| 3300002476 | Freshwater microbial communities from San Paulo Zoo lake, Brazil - NOV 2012 | Environmental | Open in IMG/M |
| 3300002835 | Freshwater microbial communities from Lake Mendota, WI - (Lake Mendota Combined Ray assembly, ASSEMBLY_DATE=20140605) | Environmental | Open in IMG/M |
| 3300003430 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD | Environmental | Open in IMG/M |
| 3300004096 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (version 2) | Environmental | Open in IMG/M |
| 3300004126 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.DN (version 2) | Environmental | Open in IMG/M |
| 3300004481 | Combined Assembly of Gp0112041, Gp0112042, Gp0112043 | Environmental | Open in IMG/M |
| 3300004787 | Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300004795 | Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.DD (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005528 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel1S_2200h metaG | Environmental | Open in IMG/M |
| 3300005805 | Microbial and algae communities from Cheney Reservoir in Wichita, Kansas, USA | Environmental | Open in IMG/M |
| 3300006025 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006030 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006033 | Freshwater microbial communities in response to fracking from Pennsylvania, USA - Allegheny Zone_MetaG_DW_15 | Environmental | Open in IMG/M |
| 3300006639 | Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Utica-2 Time Series FC 2014_7_11 | Environmental | Open in IMG/M |
| 3300006641 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_>0.8_DNA | Environmental | Open in IMG/M |
| 3300006810 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 | Environmental | Open in IMG/M |
| 3300007165 | Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Utica-2 Time Series FC 2014_7_16 | Environmental | Open in IMG/M |
| 3300007169 | Combined Assembly of cyanobacterial bloom in Marina Bay water reservoir, Singapore (Diel cycle-Bottom layer) 8 sequencing projects | Environmental | Open in IMG/M |
| 3300007202 | Combined Assembly of cyanobacterial bloom in Marina Bay water reservoir, Singapore (Monthly Sampling-Site C) 9 sequencing projects | Environmental | Open in IMG/M |
| 3300007216 | Combined Assembly of cyanobacterial bloom in Punggol water reservoir, Singapore (Diel cycle-Surface and Bottom layer) 16 sequencing projects | Environmental | Open in IMG/M |
| 3300007538 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_2 Viral MetaG | Environmental | Open in IMG/M |
| 3300007539 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1M Viral MetaG | Environmental | Open in IMG/M |
| 3300007541 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG | Environmental | Open in IMG/M |
| 3300007542 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG | Environmental | Open in IMG/M |
| 3300007960 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1D Viral MetaG | Environmental | Open in IMG/M |
| 3300008012 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_N_<0.8_DNA | Environmental | Open in IMG/M |
| 3300009056 | Estuarine microbial communities from the Columbia River estuary - metaG 1449A-3 | Environmental | Open in IMG/M |
| 3300009075 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 1-3cm March2015 | Environmental | Open in IMG/M |
| 3300009085 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 10-12cm September2015 | Environmental | Open in IMG/M |
| 3300009124 | Marine sediment microbial communities from methane seeps within Hudson Canyon, US Atlantic Margin - Hudson Canyon PC-16 72 cmbsf | Environmental | Open in IMG/M |
| 3300009165 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 1-3cm September2015 | Environmental | Open in IMG/M |
| 3300009235 | Microbial communities of water from Amazon river, Brazil - RCM10 | Environmental | Open in IMG/M |
| 3300010299 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_15_0.2_DNA | Environmental | Open in IMG/M |
| 3300010354 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_DNA | Environmental | Open in IMG/M |
| 3300010370 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.2_DNA | Environmental | Open in IMG/M |
| 3300011984 | Freshwater microbial communities from drinking water treatment plant - The University of Hong Kong - Raw_water_201107 | Environmental | Open in IMG/M |
| 3300012000 | Freshwater microbial communities from Lake Lanier in Georgia, USA - LL_1007A | Environmental | Open in IMG/M |
| 3300013087 | Freshwater microbial communities from Lake Malawi, Central Region, Malawi to study Microbial Dark Matter (Phase II) - Malawi_45m_30L | Environmental | Open in IMG/M |
| 3300016681 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES152 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300020074 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015017 Mahale Deep Cast 200m | Environmental | Open in IMG/M |
| 3300020109 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015016 Mahale Deep Cast 400m | Environmental | Open in IMG/M |
| 3300020151 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_202 megahit1 | Environmental | Open in IMG/M |
| 3300020159 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_108 megahit1 | Environmental | Open in IMG/M |
| 3300020161 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_101 megahit1 | Environmental | Open in IMG/M |
| 3300020183 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015002 Mahale S4 surface | Environmental | Open in IMG/M |
| 3300020498 | Freshwater microbial communities from Lake Mendota, WI - 13JUN2010 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020530 | Freshwater microbial communities from Lake Mendota, WI - 22OCT2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020551 | Freshwater microbial communities from Lake Mendota, WI - 27JUL2010 deep hole epilimnion ns (SPAdes) | Environmental | Open in IMG/M |
| 3300021091 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015055 Kigoma Offshore 40m | Environmental | Open in IMG/M |
| 3300021961 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_3D | Environmental | Open in IMG/M |
| 3300021964 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_34D | Environmental | Open in IMG/M |
| 3300022067 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_30 (v3) | Environmental | Open in IMG/M |
| 3300022198 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG (v3) | Environmental | Open in IMG/M |
| 3300022200 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG (v3) | Environmental | Open in IMG/M |
| 3300022747 | Freshwater microbial communities from McNutts Creek, Athens, Georgia, United States - 29-17_Aug_MG | Environmental | Open in IMG/M |
| 3300022748 | Freshwater microbial communities from McNutts Creek, Athens, Georgia, United States - 20-17_Aug_MG | Environmental | Open in IMG/M |
| 3300022752 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL_1208_BB | Environmental | Open in IMG/M |
| 3300024239 | Subsurface sediment microbial communities from gas well in Oklahoma, United States - OK STACK MC-2-E | Environmental | Open in IMG/M |
| 3300024289 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Miss_RepA_8h | Environmental | Open in IMG/M |
| 3300024354 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Yuk_RepB_8d | Environmental | Open in IMG/M |
| 3300024515 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_UVDOM_RepB_8d | Environmental | Open in IMG/M |
| 3300025283 | Freshwater microbial communities from Lake Malawi, Central Region, Malawi to study Microbial Dark Matter (Phase II) - Malawi_45m_30L (SPAdes) | Environmental | Open in IMG/M |
| 3300025585 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025646 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025647 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025674 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1M Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025732 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300026473 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Cont_RepC_8d | Environmental | Open in IMG/M |
| 3300027114 | Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Utica-2 Time Series FC 2014_7_16 (SPAdes) | Environmental | Open in IMG/M |
| 3300027121 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Yuk_RepC_8h | Environmental | Open in IMG/M |
| 3300027499 | Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Utica-2 Time Series FC 2014_7_11 (SPAdes) | Environmental | Open in IMG/M |
| 3300027683 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 1-3cm May2015 (SPAdes) | Environmental | Open in IMG/M |
| 3300027693 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 1-3cm September2015 (SPAdes) | Environmental | Open in IMG/M |
| 3300027697 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MLB.DN (SPAdes) | Environmental | Open in IMG/M |
| 3300027730 (restricted) | Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_8m | Environmental | Open in IMG/M |
| 3300027793 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel1S_2200h metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027804 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MLB.SN (SPAdes) | Environmental | Open in IMG/M |
| 3300029930 | Aquatic microbial communities from drinking water treatment plant in Pearl River Delta area, China - influent_20120727 | Environmental | Open in IMG/M |
| 3300029933 | Aquatic microbial communities from drinking water treatment plant in Pearl River Delta area, China - influent_20120727_2 | Environmental | Open in IMG/M |
| 3300031999 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G02_20 | Environmental | Open in IMG/M |
| 3300032053 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G09_16 | Environmental | Open in IMG/M |
| 3300033521 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D1_B | Environmental | Open in IMG/M |
| 3300033557 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D2_B | Environmental | Open in IMG/M |
| 3300033816 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME16Sep2004-rr0005 | Environmental | Open in IMG/M |
| 3300033978 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME28Sep2014-rr0002 | Environmental | Open in IMG/M |
| 3300033994 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME25Jul2006D11-rr0046 | Environmental | Open in IMG/M |
| 3300034012 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Aug2017-rr0027 | Environmental | Open in IMG/M |
| 3300034061 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Sep2004-rr0028 | Environmental | Open in IMG/M |
| 3300034072 | Fracking water microbial communities from deep shales in Oklahoma, United States - MC-3-A | Environmental | Open in IMG/M |
| 3300034073 | Fracking water microbial communities from deep shales in Oklahoma, United States - MC-6-XL | Environmental | Open in IMG/M |
| 3300034096 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME15Oct2015-rr0098 | Environmental | Open in IMG/M |
| 3300034101 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME19Sep2005-rr0107 | Environmental | Open in IMG/M |
| 3300034104 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Aug2005-rr0120 | Environmental | Open in IMG/M |
| 3300034283 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07Aug2003-rr0061 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| GOS2236_10566195 | 3300001968 | Marine | MTKQLLISQLRLGKNGNDILHILDALCDGMDSGESRQDNVPTLDEIQF* |
| metazooDRAFT_107610071 | 3300002476 | Lake | MTKELLISQLRQGNNGQRILEILDALCAGMDSSESSQDSASTLDEIQF* |
| B570J40625_10002514710 | 3300002835 | Freshwater | MNKEIMTTLLDQGTDGNSILSILDALCSGMDSGESSQDNVPTLDEIEF* |
| B570J40625_1000974507 | 3300002835 | Freshwater | MTKELLIAQLNLGNDGNSILSILDALCDGMDSSESSQDNAPTLDEIQF* |
| B570J40625_1010556014 | 3300002835 | Freshwater | MTKELLIAQLNLGTDGNSILSILDALCDGMDSGESSQDNVPTLDE |
| JGI25921J50272_100044875 | 3300003430 | Freshwater Lake | MNKEILTTLLDKGTDGXSILSILDALCSGMDSGESSQDNVPTLDEIEF* |
| Ga0066177_100130472 | 3300004096 | Freshwater Lake | MNKEILTTLLDKGTDGNSILSILDALCSGMDSGESSQDNVPTLDEIEF* |
| Ga0066179_101561011 | 3300004126 | Freshwater Lake | TLLDKGTDGNSILSILDALCSGMYSGESSQDNVPTLDEIEF* |
| Ga0069718_145441014 | 3300004481 | Sediment | MTKELLIAQLRLGTNGNDILSILDALCDGMDSGESRQDNGATLDEIQF* |
| Ga0007755_15910052 | 3300004787 | Freshwater Lake | MNKEILTTLLDKGTDGSSILSILDALCSGMDSGESSQDNVPTLDEIEF* |
| Ga0007756_115656841 | 3300004795 | Freshwater Lake | MNKEILTTLLDKGTDGNSILSILDALCSGMDSGESSQDNV |
| Ga0068872_1000382516 | 3300005528 | Freshwater Lake | MTKQLLISQLRQGKNGNDILHILDVLCDGVDSSESSQDNVPTLDEIQF* |
| Ga0079957_10188615 | 3300005805 | Lake | MTKQLLISQLRKGNNGQRILEILDALCAGMDSSESSQDSAPTLDEIQF* |
| Ga0079957_101956810 | 3300005805 | Lake | MTKQLLISQLRLGKNGNDILHILDALCSGMDSGESRQDNVPTLDEIQF* |
| Ga0079957_10624649 | 3300005805 | Lake | MTKQLLISQLRLGKNGNDILSILDALCSGMDTGESRQDNVPTLDEIQF* |
| Ga0075474_100032567 | 3300006025 | Aqueous | MTKQLLISQLRKGKNGNSILEILDVLCAGMGTDDSRQDNVPTLDEIEF* |
| Ga0075470_1000003366 | 3300006030 | Aqueous | MDKEIMTTLLDQAADGNGILQILDALYDGMDSGESSQDFCPTLDEIQF* |
| Ga0075012_1001170114 | 3300006033 | Watersheds | MTKELLIAQLRQGTNGHSILQILDALCDGMDSSESSQDNAPTLDEIQF* |
| Ga0079301_10254343 | 3300006639 | Deep Subsurface | MTKELLIAQLRLGKNGNDLLSILDALHNGMDSGESSQDHVPTLDEIEF* |
| Ga0079301_10273118 | 3300006639 | Deep Subsurface | MTKELLIAQLHLGKNGNDILSILDALHNGMDSGESSQDHVPTLDEIEF* |
| Ga0075471_1000010386 | 3300006641 | Aqueous | MTTLLDQAADGNGILQILDALYDGMDSGESSQDFCPTLDEIQF* |
| Ga0070754_100777453 | 3300006810 | Aqueous | MTKQLLISQLRLGKNGNDILHILDVLCNGMDSSESSQDNVPTLDEIQF* |
| Ga0079302_10046791 | 3300007165 | Deep Subsurface | MTKELLIAQLRLGKNGNDILSILDALHNGMDSGESSQDHVPTLDEIEF* |
| Ga0102976_11144512 | 3300007169 | Freshwater Lake | MTKELLTTLLNKATDGNSILSILDALCDGMDCGESSQDNVPTLDEIQF* |
| Ga0103274_12123475 | 3300007202 | Freshwater Lake | MTKQFLISQLRQGNNGQRILEILDALVDGMDSSESREDLSPTLDEIKF* |
| Ga0103961_10490692 | 3300007216 | Freshwater Lake | MTKELLIAQLRLGKNGNDIISILDALCDGMDSSESSQDNVPTLDEIQF* |
| Ga0099851_10186412 | 3300007538 | Aqueous | MTKQLLISQLRQGQNGQQIIEILELLASGVDVCESSQDLLPTLDEIQF* |
| Ga0099851_12059592 | 3300007538 | Aqueous | MTKQLLISQLRLGKNGNDILSILDALCSGMDSGESRQDNLPTLDEIQF* |
| Ga0099849_11218173 | 3300007539 | Aqueous | MTKQLLIAQLRQGQNGQRILEILDALCAGMDSSESSQDSVPTLDEIQF* |
| Ga0099848_10234105 | 3300007541 | Aqueous | MTKQLLISQLRLGKNGNDILSILDALSSGMDGGESRQDNLPTLDEIQF* |
| Ga0099848_10472751 | 3300007541 | Aqueous | MTKQLLISQLRQGQNGQRILEILDALCAGMDSSESSQDSAPTLDEIQF* |
| Ga0099848_11299172 | 3300007541 | Aqueous | MTKQLLISQLRQGQNGNDILHILDVLCNGMDSSESSQDNVPTLDEIQF* |
| Ga0099848_13365221 | 3300007541 | Aqueous | NGNDILHILDVLCNGMDSSESSQDNVPTLDEIQF* |
| Ga0099846_10611681 | 3300007542 | Aqueous | KNGNDILHILDVLCNGMDSSESSQDNVPTLDEIQF* |
| Ga0099846_12701492 | 3300007542 | Aqueous | QLRLGKNGNDILSILDALCSGMDSGESRQDNLPTLDEIQF* |
| Ga0099846_13022321 | 3300007542 | Aqueous | LLISQLRLGIDGNDILHILDVLCNGMDSSESSQDNVPTLDEIQF* |
| Ga0099850_13866652 | 3300007960 | Aqueous | LLTDTMTKQLLISQLRQGQNGQQIIEILELLASGVDVCESSQDLLPTLDEIQF* |
| Ga0075480_101296361 | 3300008012 | Aqueous | PLSSCLIMTKQLLISQLRLGKNGNDILHILDVLCNGMDSSESSQDNVPTLDEIQF* |
| Ga0102860_11570584 | 3300009056 | Estuarine | MTKELLIAQLNLGNDGNSILSILDALCDGMDSSESSQDNAPTLDEI* |
| Ga0105090_105241081 | 3300009075 | Freshwater Sediment | KQLRLGTDGNSILSILDALCDGMDSSESRQDNVPTLDEIQF* |
| Ga0105103_103599102 | 3300009085 | Freshwater Sediment | MTKELLIAQLRQGTNGNSILQILDALCDGMDSSESSQDNAPTLDEIQF* |
| Ga0118687_1000381413 | 3300009124 | Sediment | MTKQLLISQLRKGNNGQQIIEILELLASGVDVCESSQDLLPTLDEIQF* |
| Ga0105102_1000071817 | 3300009165 | Freshwater Sediment | MTKQLLIKQLRLGTDGNSILSILDALCDGMDSSESRQDNVPTLDEIQF* |
| Ga0103857_100563493 | 3300009235 | River Water | MSKDLMFTLLDRASDGHGILSILDALCSGMDCSESSEDNGPTLDEIEF* |
| Ga0129342_11659092 | 3300010299 | Freshwater To Marine Saline Gradient | MTKQLLISQLRQGQNGQRILEILDALVAGMDSSESSQDSVPTLDEIQF* |
| Ga0129333_1000616814 | 3300010354 | Freshwater To Marine Saline Gradient | MTKQLLISQLRLGIDGNSILQILDALCDGMDSGESSEDNVPTLDEIQS* |
| Ga0129333_100377984 | 3300010354 | Freshwater To Marine Saline Gradient | MTKELLISQLRQGTNGNSILEILDTLCDGVDVCESSQDNGPTLDEIQF* |
| Ga0129333_100611627 | 3300010354 | Freshwater To Marine Saline Gradient | MTKELLFAQLNLANNGQQLMDILDALAAGMDTGESSQDLCPTLDEIQF* |
| Ga0129333_100782282 | 3300010354 | Freshwater To Marine Saline Gradient | MTKQLLISQLRKGNNGNSILEILDVLCAGMGTDDSRQDNVPTLDEIEF* |
| Ga0129333_101552637 | 3300010354 | Freshwater To Marine Saline Gradient | MTKQLLINQLRLGKNGNDILHILDALCDGMDSSESSQDNVPTLDEIQF* |
| Ga0129333_104513706 | 3300010354 | Freshwater To Marine Saline Gradient | MTKQLFLSQLRQGKNGNEIMQILELLASGMDDSESREDFSPTLDEIQF* |
| Ga0129333_108026992 | 3300010354 | Freshwater To Marine Saline Gradient | MTKELLIAQLNLGTDGNSILSILDALCDGMGSSESSQDNAPTLEEIKF* |
| Ga0129333_110129952 | 3300010354 | Freshwater To Marine Saline Gradient | MTKELLIAQLRQGTNGHSILQILDALCDGMGSSESSQDNAPTLDEIQF* |
| Ga0129333_113552642 | 3300010354 | Freshwater To Marine Saline Gradient | MDKELLISQLRKGSDGNSILQILDVLCDGMDSSESRQDNVPTLDEIQF* |
| Ga0129333_114456393 | 3300010354 | Freshwater To Marine Saline Gradient | MTKQFLISQLRQGNNGQRILEILDALVAGMDTSESREDFSPTLDEIQF* |
| Ga0129336_101674232 | 3300010370 | Freshwater To Marine Saline Gradient | MTKELLISQLRQGTNGNSILEILDTLCDGMDVCESSQDNGPTLDEIQF* |
| Ga0129336_101676617 | 3300010370 | Freshwater To Marine Saline Gradient | MTKQFLISQLRQGNNGQRILEILDALVDGMDSSESREDLSP |
| Ga0129336_102444496 | 3300010370 | Freshwater To Marine Saline Gradient | MTKELLIAQLRQGTNGHSILQILDALCDGMGSSESSQDNAPTL |
| Ga0129336_104579702 | 3300010370 | Freshwater To Marine Saline Gradient | KQLLISQLRLGKNGNDILHILDVLCNGMDSSESSQDNVPTLDEIQF* |
| Ga0129336_105210621 | 3300010370 | Freshwater To Marine Saline Gradient | QLRQGTNGHSILQILDALCDGMGSSESSQDNAPTLEEIKF* |
| Ga0129336_106513842 | 3300010370 | Freshwater To Marine Saline Gradient | AQLRQGTNGHSILQILDALCDGMGSSESSQDNAPTLDEIQF* |
| Ga0119931_10052775 | 3300011984 | Drinking Water Treatment Plant | MTKQFLISQLRQGNNGQRILEILDALADGMDSSESREDLSPTLDEIKF* |
| Ga0119951_100665012 | 3300012000 | Freshwater | MTKQLLIAQLRLGKNGNDILSILDALCDGMDSGESRQDNVPTLDEIQF* |
| Ga0163212_10465684 | 3300013087 | Freshwater | CTMTKQLLISQLRLGKNGNDILSILDVLCDGMDNSESSQDNGATLDEIQF* |
| Ga0180043_1249132 | 3300016681 | Freshwater | EIMTTLLDQGTDGNSILSILDALCSGMDSGESSQDNVPTLDEIEF |
| Ga0194113_100840896 | 3300020074 | Freshwater Lake | MTKQLLISQLRLGKNGNDILSILDVLCDGMDNSESSQDNGATLDEIQF |
| Ga0194112_104005622 | 3300020109 | Freshwater Lake | TMTKQLLISQLRLGKNGNDILSILDVLCDGMDNSESSQDNGATLDEIQF |
| Ga0194112_107734604 | 3300020109 | Freshwater Lake | MTKQLLISQLRLGKNGNDILSILDVLCDGMDNSESSQDNGA |
| Ga0211736_105581532 | 3300020151 | Freshwater | MTKQFLISQLRQGNNGQRILEILDALADGMDSSESSQDILPTLDEIQF |
| Ga0211734_1098697211 | 3300020159 | Freshwater | MNKQLLFTLLDKGTDGNSILSILDALCDGMDSSESSQDNVPTLDEIQF |
| Ga0211726_1060987410 | 3300020161 | Freshwater | MTKQLLISQLRLGNNGNDILSILDALCDGMDSSESSQDNGATLDEIQF |
| Ga0194115_100686381 | 3300020183 | Freshwater Lake | LISQLRLGKNGNDILSILDALCSGMDSGESRQDNVPTLDEIQF |
| Ga0208050_10007194 | 3300020498 | Freshwater | MEKVIHSLLLTNTMTKELLIAQLNLGNDGNSILSILDALCDGMDSSESSQDNAPTLDEIQ |
| Ga0208050_10096342 | 3300020498 | Freshwater | MTKELLIAQLNLGTDGNSILSILDALCDGMDSGESSQDNVPTLDEIQF |
| Ga0208235_10021415 | 3300020530 | Freshwater | MNKEIMTTLLDQGTDGNSILSILDALCSGMDSGESSQDNVPTLDEIEF |
| Ga0208360_10207123 | 3300020551 | Freshwater | MTKELLIAQLNLGTDGNSILSILDALCDGMDSSESSQDNAPTLDEIQF |
| Ga0194133_1000310161 | 3300021091 | Freshwater Lake | MTKQLLISQLRQGKNGNDILHILDVLCNGMDSSESSQDNVPTLDEIQF |
| Ga0222714_1001947615 | 3300021961 | Estuarine Water | MTKQLLLSQLRQGKNGNEIMQILELLASGMDSSESREDFSPTLDEIKF |
| Ga0222714_100228439 | 3300021961 | Estuarine Water | MTKDLLISQLRLGKNGNDILHILDALCHGMDSGESSQDNVPTLDEIQF |
| Ga0222719_100533443 | 3300021964 | Estuarine Water | MTKQLLISQLRKGNNGQQLLEILDALCAGMDSSESSQDSAPTLDEIQF |
| Ga0196895_10012805 | 3300022067 | Aqueous | MTKQLLISQLRKGKNGNSILEILDVLCAGMGTDDSRQDNVPTLDEIEF |
| Ga0196905_10435903 | 3300022198 | Aqueous | MTKQLLISQLRQGQNGQRILEILDALCAGMDSSESSQDSAPTLDEIQF |
| Ga0196905_11931191 | 3300022198 | Aqueous | MTKQLLISQLRQGQNGQQIIEILELLASGVDVCESSQDLL |
| Ga0196901_10611161 | 3300022200 | Aqueous | MTKQLLISQLRQGQNGQQIIEILELLASGVDVCESSQDLLPTLDEIQF |
| Ga0196901_10618382 | 3300022200 | Aqueous | MTKQLLISQLRKGNNGNDILHILDVLCNGMDSSESSQDNVPTLDEIQF |
| Ga0196901_10668193 | 3300022200 | Aqueous | MTKQLLIAQLRQGQNGQRILEILDALCAGMDSSESSQDSVPTLDEIQF |
| Ga0228703_10083783 | 3300022747 | Freshwater | MTKELLISQLRQGKNGHSILEILDTIASGSDVRESSQDNVPTLDEIQF |
| Ga0228702_10213744 | 3300022748 | Freshwater | MTKQLLIAQLRLGKNGNDILSILDALCDGMDSGESRKDNVPTLDEIQF |
| Ga0214917_1000397613 | 3300022752 | Freshwater | MTKDLLISQPRLGKNGSSILSILDALCDGMDSGESSQDHVPTLEEIEF |
| Ga0214917_101455343 | 3300022752 | Freshwater | MTKQLLIAQLRLGKNGNDILSILDALCDGMDSGESRQDNVPTLDEIQF |
| Ga0214917_101935554 | 3300022752 | Freshwater | MTKQLLIAQLRLGKNGNDILSILDALCDGMDSGESCKDNVPTLDEIQF |
| Ga0247724_10623273 | 3300024239 | Deep Subsurface Sediment | MTKELLIAQLRLGKNGNDILSILDALHNGMDSGESSQDNVPTLDEIQF |
| Ga0255147_100050111 | 3300024289 | Freshwater | MTKELLISQLRLGKDGHSILSILDALCNGMDSGESSEDNVPTLDEIEF |
| Ga0255171_10550151 | 3300024354 | Freshwater | PLSSCLIMTKELLISQLRLGKDGHSILSILDALCNGMDSGESSEDNVPTLDEIEF |
| Ga0255183_10863811 | 3300024515 | Freshwater | MTKELLISQLRLGKDGHSILSILDALCNGMDSGESSEDNVPTLD |
| Ga0208048_10134131 | 3300025283 | Freshwater | CTMTKQLLISQLRLGKNGNDILSILDVLCDGMDNSESSQDNGATLDEIQF |
| Ga0208546_1000023152 | 3300025585 | Aqueous | MDKEIMTTLLDQAADGNGILQILDALYDGMDSGESSQDFCPTLDEIQF |
| Ga0208161_11396961 | 3300025646 | Aqueous | MTKQLLIAQLRQGQNGQRILEILDALCAGMDSSESSQDS |
| Ga0208161_11716832 | 3300025646 | Aqueous | MTKQLLISQLRLGKNGNDILSILDALSSGMDGGESRQDNLPTLDEIQF |
| Ga0208160_10210412 | 3300025647 | Aqueous | MTKQLLIAQLRQGQNGNDILHILDVLCNGMDSSESSQDNVPTLDEIQF |
| Ga0208162_10059263 | 3300025674 | Aqueous | MTKQLLISQLRLGKNGNDILHILDVLCNGMDSSESSQDNVPTLDEIQF |
| Ga0208784_100019419 | 3300025732 | Aqueous | MTTLLDQAADGNGILQILDALYDGMDSGESSQDFCPTLDEIQF |
| Ga0255166_10380052 | 3300026473 | Freshwater | LLISQLRLGKDGHSILSILDALCNGMDSGESSEDNVPTLDEIEF |
| Ga0208009_100182413 | 3300027114 | Deep Subsurface | MTKELLIAQLRLGKNGNDLLSILDALHNGMDSGESSQDHVPTLDEIEF |
| Ga0255074_10181992 | 3300027121 | Freshwater | MTKELLIAQLRQGTNGHSILQILDALCDGMDSSESSQDNAPTLDEIQF |
| Ga0208788_10632594 | 3300027499 | Deep Subsurface | MTKELLIAQLHLGKNGNDILSILDALHNGMDSGESSQDHVPTLDEIEF |
| Ga0209392_11668832 | 3300027683 | Freshwater Sediment | MTKQLLIKQLRLGTDGNSILSILDALCDGMDSSESRQDNVPTLDEIQF |
| Ga0209704_11881783 | 3300027693 | Freshwater Sediment | MTKELLIAQLRQGTNGNSILQILDALCDGMDSSESSQDNAPTLDEIQF |
| Ga0209033_10667203 | 3300027697 | Freshwater Lake | MNKEILTTLLDKGTDGNSILSILDALCSGMDSGESSQDNVPTLDEIEF |
| (restricted) Ga0247833_10520746 | 3300027730 | Freshwater | MTKELLIAQLRLGKNGNDIISILDALCSGMDSGESSQDYGATLDEIQF |
| Ga0209972_1000722920 | 3300027793 | Freshwater Lake | MTKQLLISQLRQGKNGNDILHILDVLCDGVDSSESSQDNVPTLDEIQF |
| Ga0209358_100311905 | 3300027804 | Freshwater Lake | MNKEILTTLLDKGTDGSSILSILDALCSGMDSGESSQDNVPTLDEIEF |
| Ga0119944_100028112 | 3300029930 | Aquatic | MNKDLLISQLRLGIDGNSILQILDALCDGMDSGESSQDFCPTLDEIQF |
| Ga0119945_10116364 | 3300029933 | Aquatic | MTKQLLISQLRTGKNGNDILHILDALCNGMDSSESSEDNVPTLDEIQF |
| Ga0315274_108612193 | 3300031999 | Sediment | LQFSSEEITMTKQLLISQLRLGNNGNDILSILDALCDGMDSSESSQDNGATLDEIQF |
| Ga0315284_111493562 | 3300032053 | Sediment | MTKQLLIDQLNLANNGQQLLEILDALAAGMDSGESSQDFLPTLDEIQFSPS |
| Ga0316616_1007901616 | 3300033521 | Soil | MTKELMIAQLRLGTNGNDILSILDALHDGMDSGESSQDTVPTLDEIQF |
| Ga0316616_1041625163 | 3300033521 | Soil | MTKELLIAQLRLGKNGNDILSILDTLCNGMDSGESSQDYVPTLDEIEF |
| Ga0316617_1003726132 | 3300033557 | Soil | MTKELLIAQLRLGKNGNDILSILDALHNGMDSGESSQDHVPTLDEIEF |
| Ga0334980_0006339_1859_2005 | 3300033816 | Freshwater | MTKQLLISQLRQGKDGNDILSILDALCSGMDSSESRQDNVPTLDEIQF |
| Ga0334980_0031009_1165_1311 | 3300033816 | Freshwater | MTKQLLISQLRQGKDGNDILSILDALCSGMDASESRQDNVPTLDEIQF |
| Ga0334980_0088469_723_869 | 3300033816 | Freshwater | MTKELLIAQLRQGTNGHSILSILDALCDGMDSSESSQDNAPTLDEIQF |
| Ga0334980_0109055_3_116 | 3300033816 | Freshwater | LGNDGNSILSILDALCDGMDSSESSQDNAPTLDEIQF |
| Ga0334977_0297445_596_742 | 3300033978 | Freshwater | MTKELLIAQLRLGNNGNDILSILDALCDGMDSGESSQDNVPTLDEISF |
| Ga0334996_0440615_92_238 | 3300033994 | Freshwater | MTKQLLISQLRQGNNGQQILEILELLASGMDSSESSQDSAPTLDEIQF |
| Ga0334986_0331587_295_441 | 3300034012 | Freshwater | MTKELLIAQLNLGNDGNSILSILDALCDGMDSSESSQDNAPTLDEIQF |
| Ga0334987_0008684_7763_7909 | 3300034061 | Freshwater | MTKELLIAQLRQGTNGNSILQILDALCDGMDSSESSEGIIPTLDEIQF |
| Ga0334987_0506077_3_119 | 3300034061 | Freshwater | MTKQLLISQLRQGKDGNDILSILDALCSGMDSSESRQDN |
| Ga0334987_0821920_353_499 | 3300034061 | Freshwater | MTKQLLISQLRKGNNGQRILEILDALAAGMDSSESSQDILPTLDEIKF |
| Ga0310127_088911_1200_1346 | 3300034072 | Fracking Water | MTKELLIAQLRLGKNGNDILSILDALHNGMDSGESSQDNVPTVDEIQF |
| Ga0310130_0144384_328_474 | 3300034073 | Fracking Water | MTKQLLISQLRQGQNGNDILHILDVLCNGMDSSESSQDNVPTLDEIQF |
| Ga0335025_0616620_96_242 | 3300034096 | Freshwater | MTKQLLISQLRLGKNGNDILSILDALCNGMDSGESRQDNVPTLDEIQF |
| Ga0335027_0029474_4062_4208 | 3300034101 | Freshwater | MTKELLIAQLRLGKNGNDLLSILDALHNGMDSSESSQDHVPTLDEISF |
| Ga0335031_0835786_398_511 | 3300034104 | Freshwater | MTKELLIAQLNLGTDGNSILSILDALCDGMDSSESSQD |
| Ga0335007_0029368_958_1104 | 3300034283 | Freshwater | MTKELLIAQLRQGTNGNSILSILDALCDGMDSSESSQDTIPTLDEIQF |
| ⦗Top⦘ |