NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0334977_0194093

Scaffold Ga0334977_0194093


Overview

Basic Information
Taxon OID3300033978 Open in IMG/M
Scaffold IDGa0334977_0194093 Open in IMG/M
Source Dataset NameFreshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME28Sep2014-rr0002
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1025
Total Scaffold Genes4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)3 (75.00%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Associated Families3

Taxonomy
All Organisms → Viruses → Predicted Viral(Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater → Freshwater Microbial Communities From Lake Mendota, Crystal Bog Lake, And Trout Bog Lake In Wisconsin, United States

Source Dataset Sampling Location
Location NameUSA: Wisconsin
CoordinatesLat. (o)43.0995Long. (o)-89.4045Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F002245Metagenome / Metatranscriptome578Y
F004051Metagenome / Metatranscriptome455Y
F103246Metagenome / Metatranscriptome101Y

Sequences

Protein IDFamilyRBSSequence
Ga0334977_0194093_1_162F103246AGGMSRQITVKVATTKVIKALEATLAKLENDYNTQAQKEAKFGKAQEAWRKEIGKWA
Ga0334977_0194093_300_479F004051GAGGMTIGGKLYQVGDLFTTLKSKRTGVIKEIHPQASGSVRVLLELPSKETRWTSVSAKTLLG
Ga0334977_0194093_837_1025F002245N/AFEAIIDLDKIPANLLPRLIALDTYSVTKMCKEATLHALGMSNVLPLANENNTWAEITIKGDN

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.