| Basic Information | |
|---|---|
| Family ID | F103246 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 101 |
| Average Sequence Length | 47 residues |
| Representative Sequence | MSRAITVKVATPKVIKALETRLATLEKDYASQTANEAKFQKAHEAW |
| Number of Associated Samples | 86 |
| Number of Associated Scaffolds | 101 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 100.00 % |
| % of genes near scaffold ends (potentially truncated) | 100.00 % |
| % of genes from short scaffolds (< 2000 bps) | 87.13 % |
| Associated GOLD sequencing projects | 81 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.45 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (53.465 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake (19.802 % of family members) |
| Environment Ontology (ENVO) | Unclassified (56.436 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (67.327 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 47.30% β-sheet: 0.00% Coil/Unstructured: 52.70% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.45 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 101 Family Scaffolds |
|---|---|---|
| PF06491 | Disulph_isomer | 0.99 |
| PF06067 | DUF932 | 0.99 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 53.47 % |
| All Organisms | root | All Organisms | 46.53 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000736|JGI12547J11936_1027940 | All Organisms → Viruses → Predicted Viral | 1282 | Open in IMG/M |
| 3300000756|JGI12421J11937_10061995 | All Organisms → Viruses → Predicted Viral | 1158 | Open in IMG/M |
| 3300002307|JGI24890J29729_1041627 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 896 | Open in IMG/M |
| 3300003413|JGI25922J50271_10046893 | Not Available | 980 | Open in IMG/M |
| 3300004772|Ga0007791_10061363 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1194 | Open in IMG/M |
| 3300004792|Ga0007761_11363006 | Not Available | 940 | Open in IMG/M |
| 3300004836|Ga0007759_10191788 | Not Available | 538 | Open in IMG/M |
| 3300005517|Ga0070374_10300905 | Not Available | 814 | Open in IMG/M |
| 3300005517|Ga0070374_10408928 | Not Available | 682 | Open in IMG/M |
| 3300005517|Ga0070374_10478567 | Not Available | 622 | Open in IMG/M |
| 3300005662|Ga0078894_11223340 | Not Available | 635 | Open in IMG/M |
| 3300005662|Ga0078894_11604851 | Not Available | 536 | Open in IMG/M |
| 3300006484|Ga0070744_10049269 | Not Available | 1237 | Open in IMG/M |
| 3300007547|Ga0102875_1245738 | Not Available | 548 | Open in IMG/M |
| 3300007550|Ga0102880_1154806 | Not Available | 600 | Open in IMG/M |
| 3300007553|Ga0102819_1031983 | Not Available | 892 | Open in IMG/M |
| 3300007617|Ga0102897_1148133 | Not Available | 714 | Open in IMG/M |
| 3300007630|Ga0102903_1227020 | Not Available | 505 | Open in IMG/M |
| 3300007644|Ga0102902_1174878 | Not Available | 635 | Open in IMG/M |
| 3300007716|Ga0102867_1226691 | Not Available | 518 | Open in IMG/M |
| 3300007860|Ga0105735_1000241 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 4753 | Open in IMG/M |
| 3300007861|Ga0105736_1051231 | Not Available | 828 | Open in IMG/M |
| 3300008107|Ga0114340_1024504 | All Organisms → Viruses → Predicted Viral | 2811 | Open in IMG/M |
| 3300008107|Ga0114340_1058366 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403 | 1665 | Open in IMG/M |
| 3300008107|Ga0114340_1182110 | All Organisms → Viruses → Predicted Viral | 1424 | Open in IMG/M |
| 3300008108|Ga0114341_10050442 | All Organisms → Viruses → Predicted Viral | 2711 | Open in IMG/M |
| 3300008113|Ga0114346_1153213 | Not Available | 981 | Open in IMG/M |
| 3300008113|Ga0114346_1190957 | Not Available | 828 | Open in IMG/M |
| 3300008116|Ga0114350_1061802 | Not Available | 1314 | Open in IMG/M |
| 3300008261|Ga0114336_1089865 | All Organisms → Viruses → Predicted Viral | 1467 | Open in IMG/M |
| 3300008262|Ga0114337_1089521 | All Organisms → Viruses → Predicted Viral | 3178 | Open in IMG/M |
| 3300008957|Ga0104239_1013292 | Not Available | 741 | Open in IMG/M |
| 3300008995|Ga0102888_1067342 | Not Available | 705 | Open in IMG/M |
| 3300009049|Ga0102911_1155496 | Not Available | 648 | Open in IMG/M |
| 3300009049|Ga0102911_1220523 | Not Available | 533 | Open in IMG/M |
| 3300009058|Ga0102854_1084197 | Not Available | 911 | Open in IMG/M |
| 3300009059|Ga0102830_1199598 | Not Available | 585 | Open in IMG/M |
| 3300009152|Ga0114980_10656681 | Not Available | 590 | Open in IMG/M |
| 3300009154|Ga0114963_10119248 | All Organisms → Viruses → Predicted Viral | 1594 | Open in IMG/M |
| 3300009160|Ga0114981_10679203 | Not Available | 545 | Open in IMG/M |
| 3300009180|Ga0114979_10136819 | All Organisms → Viruses → Predicted Viral | 1503 | Open in IMG/M |
| 3300009684|Ga0114958_10059353 | All Organisms → Viruses → Predicted Viral | 2034 | Open in IMG/M |
| 3300010157|Ga0114964_10554678 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 540 | Open in IMG/M |
| 3300012000|Ga0119951_1103852 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 674 | Open in IMG/M |
| 3300012012|Ga0153799_1102831 | Not Available | 507 | Open in IMG/M |
| 3300012733|Ga0157606_1194342 | Not Available | 825 | Open in IMG/M |
| 3300012758|Ga0138285_1100379 | All Organisms → Viruses → Predicted Viral | 1079 | Open in IMG/M |
| 3300012773|Ga0138290_1166093 | Not Available | 560 | Open in IMG/M |
| 3300017701|Ga0181364_1025919 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 955 | Open in IMG/M |
| 3300017701|Ga0181364_1040912 | Not Available | 739 | Open in IMG/M |
| 3300017766|Ga0181343_1050148 | Not Available | 1230 | Open in IMG/M |
| 3300017766|Ga0181343_1075957 | Not Available | 967 | Open in IMG/M |
| 3300017774|Ga0181358_1145242 | Not Available | 814 | Open in IMG/M |
| 3300020159|Ga0211734_10621698 | Not Available | 1320 | Open in IMG/M |
| 3300020515|Ga0208234_1037908 | Not Available | 536 | Open in IMG/M |
| 3300020565|Ga0208718_1027660 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium | 1134 | Open in IMG/M |
| 3300023174|Ga0214921_10489918 | Not Available | 589 | Open in IMG/M |
| 3300023184|Ga0214919_10406468 | Not Available | 880 | Open in IMG/M |
| 3300024346|Ga0244775_10044152 | All Organisms → Viruses → Predicted Viral | 3911 | Open in IMG/M |
| 3300025400|Ga0208387_1020926 | All Organisms → Viruses → Predicted Viral | 1184 | Open in IMG/M |
| 3300025435|Ga0208618_1022568 | All Organisms → Viruses → Predicted Viral | 1242 | Open in IMG/M |
| 3300025742|Ga0255248_1039342 | Not Available | 551 | Open in IMG/M |
| 3300025773|Ga0208104_1007302 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1559 | Open in IMG/M |
| 3300025838|Ga0208872_1258948 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 553 | Open in IMG/M |
| 3300026454|Ga0256319_1080633 | Not Available | 639 | Open in IMG/M |
| 3300027127|Ga0255071_1054357 | Not Available | 577 | Open in IMG/M |
| 3300027133|Ga0255070_1001024 | Not Available | 6139 | Open in IMG/M |
| 3300027142|Ga0255065_1016895 | All Organisms → Viruses → Predicted Viral | 1455 | Open in IMG/M |
| 3300027196|Ga0208438_1081479 | Not Available | 525 | Open in IMG/M |
| 3300027244|Ga0208173_1027195 | All Organisms → Viruses → Predicted Viral | 1098 | Open in IMG/M |
| 3300027259|Ga0208178_1023985 | All Organisms → Viruses → Predicted Viral | 1132 | Open in IMG/M |
| 3300027278|Ga0208439_1089196 | Not Available | 558 | Open in IMG/M |
| 3300027291|Ga0255139_1007910 | All Organisms → Viruses → Predicted Viral | 2498 | Open in IMG/M |
| 3300027563|Ga0209552_1054688 | All Organisms → Viruses → Predicted Viral | 1126 | Open in IMG/M |
| 3300027578|Ga0255075_1004190 | All Organisms → Viruses → Predicted Viral | 3169 | Open in IMG/M |
| 3300027581|Ga0209651_1074149 | Not Available | 983 | Open in IMG/M |
| 3300027581|Ga0209651_1080789 | Not Available | 932 | Open in IMG/M |
| 3300027601|Ga0255079_1007550 | All Organisms → Viruses → Predicted Viral | 2714 | Open in IMG/M |
| 3300027679|Ga0209769_1168234 | Not Available | 689 | Open in IMG/M |
| 3300027697|Ga0209033_1143039 | Not Available | 750 | Open in IMG/M |
| 3300027749|Ga0209084_1282323 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 633 | Open in IMG/M |
| 3300027754|Ga0209596_1089226 | All Organisms → Viruses → Predicted Viral | 1482 | Open in IMG/M |
| 3300027756|Ga0209444_10095255 | All Organisms → Viruses → Predicted Viral | 1228 | Open in IMG/M |
| 3300027763|Ga0209088_10133547 | All Organisms → Viruses → Predicted Viral | 1110 | Open in IMG/M |
| 3300027763|Ga0209088_10134392 | All Organisms → Viruses → Predicted Viral | 1105 | Open in IMG/M |
| 3300027770|Ga0209086_10150469 | All Organisms → Viruses → Predicted Viral | 1126 | Open in IMG/M |
| 3300027892|Ga0209550_10522407 | Not Available | 709 | Open in IMG/M |
| 3300027974|Ga0209299_1167683 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 819 | Open in IMG/M |
| 3300028025|Ga0247723_1026722 | All Organisms → Viruses → Predicted Viral | 1868 | Open in IMG/M |
| 3300028025|Ga0247723_1032546 | All Organisms → Viruses → Predicted Viral | 1626 | Open in IMG/M |
| 3300028025|Ga0247723_1039738 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403 | 1410 | Open in IMG/M |
| 3300031784|Ga0315899_10178088 | Not Available | 2155 | Open in IMG/M |
| 3300031784|Ga0315899_10317887 | Not Available | 1535 | Open in IMG/M |
| 3300031963|Ga0315901_10432111 | All Organisms → Viruses → Predicted Viral | 1046 | Open in IMG/M |
| 3300032050|Ga0315906_10314557 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403 | 1403 | Open in IMG/M |
| 3300032093|Ga0315902_11285956 | Not Available | 517 | Open in IMG/M |
| 3300033978|Ga0334977_0194093 | All Organisms → Viruses → Predicted Viral | 1025 | Open in IMG/M |
| 3300033978|Ga0334977_0194398 | All Organisms → Viruses → Predicted Viral | 1024 | Open in IMG/M |
| 3300033981|Ga0334982_0061257 | All Organisms → Viruses → Predicted Viral | 2053 | Open in IMG/M |
| 3300033995|Ga0335003_0254893 | Not Available | 810 | Open in IMG/M |
| 3300034020|Ga0335002_0070030 | All Organisms → Viruses → Predicted Viral | 2464 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 19.80% |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 15.84% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 13.86% |
| Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 8.91% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 7.92% |
| Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 7.92% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater | 4.95% |
| Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 4.95% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 3.96% |
| Deep Subsurface Sediment | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface Sediment | 2.97% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 1.98% |
| Estuary Water | Environmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water | 1.98% |
| Estuarine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine | 1.98% |
| Freshwater And Sediment | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater And Sediment | 0.99% |
| Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Lentic | 0.99% |
| Freshwater And Sediment | Environmental → Aquatic → Freshwater → Lentic → Hypolimnion → Freshwater And Sediment | 0.99% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000736 | Freshwater microbial communities from dead zone in Lake Erie, Canada - CCB epilimnion July 2011 | Environmental | Open in IMG/M |
| 3300000756 | Freshwater microbial communities from dead zone in Lake Erie, Canada - CCB hypolimnion July 2011 | Environmental | Open in IMG/M |
| 3300002307 | Lentic bog actinobacteria communities from Grosse Fuchskuhle, Germany - Sample acI-C2 co-culture F-D7 | Environmental | Open in IMG/M |
| 3300003413 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.DD | Environmental | Open in IMG/M |
| 3300004772 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - MA0.5M | Environmental | Open in IMG/M |
| 3300004792 | Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM110.SD (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300004836 | Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.DN (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005517 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (version 4) | Environmental | Open in IMG/M |
| 3300005662 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 4) | Environmental | Open in IMG/M |
| 3300006484 | Estuarine microbial communities from the Columbia River estuary, USA - metaG S.535 | Environmental | Open in IMG/M |
| 3300007547 | Estuarine microbial communities from the Columbia River estuary - metaG 1547B-02 | Environmental | Open in IMG/M |
| 3300007550 | Estuarine microbial communities from the Columbia River estuary - metaG 1549A-3 | Environmental | Open in IMG/M |
| 3300007553 | Estuarine microbial communities from the Columbia River estuary - Ebb tide non-ETM metaG S.689 | Environmental | Open in IMG/M |
| 3300007617 | Estuarine microbial communities from the Columbia River estuary - metaG 1554B-02 | Environmental | Open in IMG/M |
| 3300007630 | Estuarine microbial communities from the Columbia River estuary - metaG 1555C-02 | Environmental | Open in IMG/M |
| 3300007644 | Estuarine microbial communities from the Columbia River estuary - metaG 1555B-02 | Environmental | Open in IMG/M |
| 3300007716 | Estuarine microbial communities from the Columbia River estuary - metaG 1546B-3 | Environmental | Open in IMG/M |
| 3300007860 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1372A_3um | Environmental | Open in IMG/M |
| 3300007861 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1372B_3um | Environmental | Open in IMG/M |
| 3300008107 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0046-3-NA | Environmental | Open in IMG/M |
| 3300008108 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0048-C-NA | Environmental | Open in IMG/M |
| 3300008113 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample E2014-0050-3-NA | Environmental | Open in IMG/M |
| 3300008116 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0106-3-NA | Environmental | Open in IMG/M |
| 3300008261 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, sample HABS-E2014-0024-C-NA | Environmental | Open in IMG/M |
| 3300008262 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0046-C-NA | Environmental | Open in IMG/M |
| 3300008957 | Freshwater microbial communities from Lake Lanier in Georgia, USA - LL_1007_MT2 | Environmental | Open in IMG/M |
| 3300008995 | Estuarine microbial communities from the Columbia River estuary - metaG 1551A-3 | Environmental | Open in IMG/M |
| 3300009049 | Estuarine microbial communities from the Columbia River estuary - metaG 1558A-02 | Environmental | Open in IMG/M |
| 3300009058 | Estuarine microbial communities from the Columbia River estuary - metaG 1370A-02 | Environmental | Open in IMG/M |
| 3300009059 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.703 | Environmental | Open in IMG/M |
| 3300009152 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_EF_MetaG | Environmental | Open in IMG/M |
| 3300009154 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_131016_EF_MetaG | Environmental | Open in IMG/M |
| 3300009160 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_MF_MetaG | Environmental | Open in IMG/M |
| 3300009180 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140625_EF_MetaG | Environmental | Open in IMG/M |
| 3300009684 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130208_EF_MetaG | Environmental | Open in IMG/M |
| 3300010157 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_131016_MF_MetaG | Environmental | Open in IMG/M |
| 3300012000 | Freshwater microbial communities from Lake Lanier in Georgia, USA - LL_1007A | Environmental | Open in IMG/M |
| 3300012012 | Freshwater microbial communities from Eastern Basin Lake Erie, Ontario, Canada - Station 879 - Top - Depth 1m | Environmental | Open in IMG/M |
| 3300012733 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES131 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012758 | Freshwater microbial communities from Lake Simoncouche, Canada - S_130626_E_mt (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012773 | Freshwater microbial communities from Lake Simoncouche, Canada - S_140212_E_mt (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300017701 | Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MM110.S.N | Environmental | Open in IMG/M |
| 3300017766 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MLB.S.D | Environmental | Open in IMG/M |
| 3300017774 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.D | Environmental | Open in IMG/M |
| 3300020159 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_108 megahit1 | Environmental | Open in IMG/M |
| 3300020515 | Freshwater microbial communities from Lake Mendota, WI - 27SEP2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020565 | Freshwater microbial communities from Lake Mendota, WI - 29APR2009 deep hole epilimnion ns (SPAdes) | Environmental | Open in IMG/M |
| 3300023174 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1505 | Environmental | Open in IMG/M |
| 3300023184 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1503 | Environmental | Open in IMG/M |
| 3300024346 | Whole water sample coassembly | Environmental | Open in IMG/M |
| 3300025400 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH27Jul09 (SPAdes) | Environmental | Open in IMG/M |
| 3300025435 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE18Jul08 (SPAdes) | Environmental | Open in IMG/M |
| 3300025742 | Metatranscriptome of freshwater microbial communities from St. Lawrence River, New York, United States - Law_Cont_RepC_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300025773 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE29May09 (SPAdes) | Environmental | Open in IMG/M |
| 3300025838 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH12Aug08 (SPAdes) | Environmental | Open in IMG/M |
| 3300026454 | Metatranscriptome of freshwater microbial communities from St. Lawrence River, New York, United States - Law_Colum_RepA_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300027127 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Miss_RepC_8h | Environmental | Open in IMG/M |
| 3300027133 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Miss_RepB_8h | Environmental | Open in IMG/M |
| 3300027142 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Cont_RepC_0h | Environmental | Open in IMG/M |
| 3300027196 | Estuarine microbial communities from the Columbia River estuary - Flood tide non-ETM metaG S.545 (SPAdes) | Environmental | Open in IMG/M |
| 3300027244 | Estuarine microbial communities from the Columbia River estuary - metaG 1555C-02 (SPAdes) | Environmental | Open in IMG/M |
| 3300027259 | Estuarine microbial communities from the Columbia River estuary - metaG 1568A-3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027278 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.703 (SPAdes) | Environmental | Open in IMG/M |
| 3300027291 | Freshwater microbial communities from St. Lawrence River, New York, United States - Law_Colum_RepB_8d | Environmental | Open in IMG/M |
| 3300027563 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.SD (SPAdes) | Environmental | Open in IMG/M |
| 3300027578 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Law_RepA_8h | Environmental | Open in IMG/M |
| 3300027581 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM110.SN (SPAdes) | Environmental | Open in IMG/M |
| 3300027601 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Atlam_RepB_8h | Environmental | Open in IMG/M |
| 3300027679 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.DN (SPAdes) | Environmental | Open in IMG/M |
| 3300027697 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MLB.DN (SPAdes) | Environmental | Open in IMG/M |
| 3300027749 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027754 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027756 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.DN (SPAdes) | Environmental | Open in IMG/M |
| 3300027763 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140625_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027770 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130207_XF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027892 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (SPAdes) | Environmental | Open in IMG/M |
| 3300027974 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300028025 | Subsurface sediment microbial communities from gas well in West Virginia, United States - MSEEL Well Study Marcellus 5H_FC | Environmental | Open in IMG/M |
| 3300031784 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA112 | Environmental | Open in IMG/M |
| 3300031963 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA116 | Environmental | Open in IMG/M |
| 3300032050 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA122 | Environmental | Open in IMG/M |
| 3300032093 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA117 | Environmental | Open in IMG/M |
| 3300033978 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME28Sep2014-rr0002 | Environmental | Open in IMG/M |
| 3300033981 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME24Aug2014-rr0011 | Environmental | Open in IMG/M |
| 3300033995 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME23May2014-rr0056 | Environmental | Open in IMG/M |
| 3300034020 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07Aug2015-rr0055 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI12547J11936_10279405 | 3300000736 | Freshwater And Sediment | MSRAITVKVATPKVIKALETRLATLEKDYASQEAKEAKYQKALEAWRKEIGKWA |
| JGI12421J11937_100619954 | 3300000756 | Freshwater And Sediment | MSRAITVKVATPKVIKALEARLAELETNYATQEAKEAKFQKAQEAWRK |
| JGI24890J29729_10416274 | 3300002307 | Lentic | MSRAITVKVATPKVIKALETKLASIKSDYANQEKYEAKYQKEVEAWKKSL |
| JGI25922J50271_100468934 | 3300003413 | Freshwater Lake | MSRQITVKVATSKVIKALEARLATLENDYNTQTAKEAKFGKAQEAWRKEI |
| Ga0007791_100613631 | 3300004772 | Freshwater | MSRAITVKVATPKVIKALETKLATLKADKENEASNEAKFQKSLEKWKKEISAYAVAN |
| Ga0007761_113630064 | 3300004792 | Freshwater Lake | MSRQITVKVATTKVIKALETRLATLEKDYASQSEKEAKFQKA |
| Ga0007759_101917881 | 3300004836 | Freshwater Lake | MSRQITVKVATTKVIKALETRLATLEKDYASQSEKEAKFQKAVEA |
| Ga0070374_103009051 | 3300005517 | Freshwater Lake | MARGKAINVKIATAKVIKALETKLATLEKDYATQTEKEAKFGKKQEAWKKEIAKWAIENF |
| Ga0070374_104089281 | 3300005517 | Freshwater Lake | MSRQITVKVATTKVIKALETKLAQIEKDYASQGENEAKYAKAV |
| Ga0070374_104785671 | 3300005517 | Freshwater Lake | MSRQITVKVATTKVIKALEARLATLENDYNTQTAKEAKFGKAQEAWRKEIG |
| Ga0078894_112233401 | 3300005662 | Freshwater Lake | MSRAITVKVATPKVIKALETKLATIKKDYAEQGANE |
| Ga0078894_116048511 | 3300005662 | Freshwater Lake | MSRAITVKVATPKVIKALETKLATIKKDYAEQGANEAKYEKARK |
| Ga0070744_100492695 | 3300006484 | Estuarine | MSSKALTVKVSVAKVIKALETKLAQVEKNFVSQEASEAKYQKAQ |
| Ga0102875_12457383 | 3300007547 | Estuarine | MSRQITVKVATTKVIKALETRLATLEKDYASQEAKEAKFQKAV |
| Ga0102880_11548061 | 3300007550 | Estuarine | MARAITVKVATPKVIKALETKLATLETQMANQEKVEAKYQKEYEKYRK |
| Ga0102819_10319834 | 3300007553 | Estuarine | MTRAITVKVATTKVIKALETRLATLEKDYASQTANEAKFQKAYEAWKKEIG |
| Ga0102897_11481331 | 3300007617 | Estuarine | MSRGKSINVKIPTARVIKALEAKLAELEQDYATQTEKEAKFGKKQEAWKKEIAKWAIENFSK |
| Ga0102903_12270202 | 3300007630 | Estuarine | MSRAITVKVAVVKVIKALEARLAELETNYSSQEAKEAKYQKAVEAW |
| Ga0102902_11748781 | 3300007644 | Estuarine | MTRAITVKVATTKVIKALETRLATLEKDYASQSEKEAK |
| Ga0102867_12266911 | 3300007716 | Estuarine | MTRAITVKVATTKVIKALETRLATLEKDYASQTANEAK |
| Ga0105735_10002411 | 3300007860 | Estuary Water | MSSRAITVKVAVVKVIKALEARLAELETNYSTQEAKEAKYQKSVEAW |
| Ga0105736_10512311 | 3300007861 | Estuary Water | MSRAITVKVATPKVIKALETRLATLEKDYASQAVNEAKYNKAVEAWRKEIGKWAIA |
| Ga0114340_10245049 | 3300008107 | Freshwater, Plankton | MSRQITVKVATTKVIKALENRLAELEKNYATQGANEAKFQKAQEAWRKEIGKWAMTKFS |
| Ga0114340_10583666 | 3300008107 | Freshwater, Plankton | MSRQITVKVATSKVIKALEARLATLENDYNTQTAKEAKFGKAQEAWRKE |
| Ga0114340_11821101 | 3300008107 | Freshwater, Plankton | MSRQITVKVATTKVIKALETRLATLEKDYATQGANE |
| Ga0114341_100504428 | 3300008108 | Freshwater, Plankton | MSRQITVKVATTKVIKALENRLAELEKNYATQGANEAKFQKAQEAWRKEIGKWAMTKFSKAE |
| Ga0114346_11532134 | 3300008113 | Freshwater, Plankton | MSRQITVKVATSKVIKALEARLATLENDYNTQTAKEAKFGKAQEAW |
| Ga0114346_11909574 | 3300008113 | Freshwater, Plankton | MSRAITVKVATPKVIKALETKLATIKKDYAEQGANEA |
| Ga0114350_10618026 | 3300008116 | Freshwater, Plankton | MSRAITVKVATPKVIKALETKLATIKKDYAEQGANEAKFQKAQEKWRKE |
| Ga0114336_10898656 | 3300008261 | Freshwater, Plankton | MSRQITVKVATSKVIKALEARLATLENDYNTQTAKEAKF |
| Ga0114337_108952110 | 3300008262 | Freshwater, Plankton | MSRQITVKVATTKVIKALEARLATLENDYNTQTAKEAKFGKAQEAWRKE |
| Ga0104239_10132921 | 3300008957 | Freshwater | MSRAITVKVATPKVIKALETKLAELNKSWATQGENEAKYEKAREKWRKEVG |
| Ga0102888_10673423 | 3300008995 | Estuarine | MSRAITVKVATPKVIKALETRLAQLEKDYATQGANEAKYQKAQEK |
| Ga0102911_11554963 | 3300009049 | Estuarine | MSRAITVKVATPKVIKALETRLAELEKNYASQEANEAKYK |
| Ga0102911_12205231 | 3300009049 | Estuarine | MTRAITVKVATTKVIKALETRLATLEKDYASQEAKEAKFQKAVEAWRK |
| Ga0102854_10841971 | 3300009058 | Estuarine | MSRQITVKVATSKVIKALEGTLAKLENDYNTQTAKEAKFGKA |
| Ga0102830_11995982 | 3300009059 | Estuarine | MSRQITVKVATVKVIKALEARLATLENDYNTQTAKEAKFGKAQEAWRKEIAKWA |
| Ga0114980_106566811 | 3300009152 | Freshwater Lake | MPKAITVKVATPKVIKALEARLATLEKDYASQAEKEAKFQENHTAWKKEIGDWAVKNFAKAENF |
| Ga0114963_101192485 | 3300009154 | Freshwater Lake | MTRAITVKVATPKVIKALEARLAELETNYATQETKEAEHTKAVE |
| Ga0114981_106792032 | 3300009160 | Freshwater Lake | MPKAITVKVATPKVIKALEARLATLEKDYASQAEKEAKFQENHTAWKKEIGDWAVKNFA |
| Ga0114979_101368191 | 3300009180 | Freshwater Lake | MSRQITVKVATTKVIKALETRLATLEKDYASQSEKEAKFQK |
| Ga0114958_100593536 | 3300009684 | Freshwater Lake | MTRAITVKVATPKVIKALEARLAELETNYATQEAKEAKHTKAVEAWKKEI |
| Ga0114964_105546783 | 3300010157 | Freshwater Lake | MSRAITVKVATPKVIKALETKLATLKADKENEASNEAKYQKAMEKWRKEI |
| Ga0119951_11038521 | 3300012000 | Freshwater | MSRAITVKVATPKVIKALETRLAQLEKDYATQADKEAKFGKLQEAWRKEIGAWAI |
| Ga0153799_11028311 | 3300012012 | Freshwater | MSRQITVKVATTKVIKALETRLATLEKDYASQSEKEAKFQKSVEAWRKEIGKWAIAN |
| Ga0157606_11943423 | 3300012733 | Freshwater | MSRQITVKVATTKVIKALETRLATLEKDYASQEAKEAKYQKVSVPHKT |
| Ga0138285_11003791 | 3300012758 | Freshwater Lake | MSRAITVKVATPKVIKALETRLATLEKDYASQTANEAKFQKAHEAW |
| Ga0138290_11660932 | 3300012773 | Freshwater Lake | MSRQITVKVATTKVIKALETRLATLEKDYASQSEKEAKFQKAVEAW |
| Ga0181364_10259191 | 3300017701 | Freshwater Lake | MSKALTVKVPTAKVIKALETKLVTVKKEKETEPALEAKY |
| Ga0181364_10409123 | 3300017701 | Freshwater Lake | MSRQITVKVATTKVIKALETRLATLEKDYASQSEKEA |
| Ga0181343_10501481 | 3300017766 | Freshwater Lake | MSRAITVKVATPKVIKALETKLANIKKEYAEQGANEAKFEKAREK |
| Ga0181343_10759574 | 3300017766 | Freshwater Lake | MSRQITVKVATTKVIKALETRLATLEKDYASQEAKEAKYQKAV |
| Ga0181358_11452423 | 3300017774 | Freshwater Lake | MSRQITVKVATTKVIKALETRLATLEKDYASQSEKEAKFQKAVEAWRKE |
| Ga0211734_106216985 | 3300020159 | Freshwater | MTRAITVKVATPKVIKALENRLAEIEQNYANQTENEAKFTT |
| Ga0208234_10379081 | 3300020515 | Freshwater | MARGKAINVKIATAKVIKALEAKLATLEKDYATQTEKEAKFGKKQEAWKKEI |
| Ga0208718_10276601 | 3300020565 | Freshwater | MARNTKSISVKIATPKVIKALETRLAELETNYANQEVNEAKYVKAMEKWKKEITT |
| Ga0214921_104899182 | 3300023174 | Freshwater | MSSRAITVKVAVVKVIKALEARLAELETNYSSQEAKEAKYQKAVEAWKKEIGKWAIANFS |
| Ga0214919_104064681 | 3300023184 | Freshwater | MSRAITVKVATPKVIKALETRLATLEKDYASQTANEAKYQKAVEA |
| Ga0244775_1004415217 | 3300024346 | Estuarine | MSRAITVKVATPKVIKALETKLAQIKKEYAEQGANEAKY |
| Ga0208387_10209264 | 3300025400 | Freshwater | MARALTVKVATPKVIKALETKLATVKKDKENEASNEAKF |
| Ga0208618_10225684 | 3300025435 | Freshwater | MARTLTVKVATPKVIKALEAKLETIKSDYASQAENEAK |
| Ga0255248_10393422 | 3300025742 | Freshwater | MSRQITVKVATNKVIKALEARLATLENDYNTQTAKE |
| Ga0208104_10073021 | 3300025773 | Freshwater | MASRSITVKVATPKVIAALEAKLAQIQNDFVNQYQ |
| Ga0208872_12589481 | 3300025838 | Freshwater | MARTLTVKVATPKVIKALEAKLETIKSDYASQAENEAKYEQARKDW |
| Ga0256319_10806332 | 3300026454 | Freshwater | MSRQITVKVATTKVIKALEARLATLENDYNTQTAKEAKFGKAQEA |
| Ga0255071_10543572 | 3300027127 | Freshwater | MTRAITVKVATTKVIKALETRLATLEKDYSSQEAKEA |
| Ga0255070_100102422 | 3300027133 | Freshwater | MTRAITVKVATTKVIKALETRLATLEKDYSSQEAKEAKYQKAVEAWRKEIGKW |
| Ga0255065_10168951 | 3300027142 | Freshwater | MSRQITVKVATTKVIKALETRLATLEKDYASQSEKEAKFQKAVEAWRKEIGKWAIANF |
| Ga0208438_10814792 | 3300027196 | Estuarine | MSRQITVKVATSKVIKALEGTLAKLENDYNTQTAKEAKFGKAQEAWRKEIG |
| Ga0208173_10271951 | 3300027244 | Estuarine | MTRAITVKVATTKVIKALETRLATLEKDYASQTAN |
| Ga0208178_10239851 | 3300027259 | Estuarine | MTRAITVKVATTKVIKALETRLATLEKDYASQTANEAKFQKAYEAWKKEIGKW |
| Ga0208439_10891963 | 3300027278 | Estuarine | MSRAITVKVATPKVIKALETKLAQIKKDYAEQGANEAKYEKAREKW |
| Ga0255139_10079101 | 3300027291 | Freshwater | MSRQITVKVATTKVIKALEARLATLENDYNTQTAKEAK |
| Ga0209552_10546885 | 3300027563 | Freshwater Lake | MSRQITVKVATTKVIKALETRLATLEKDYASQSEKEAKFQKAVE |
| Ga0255075_10041901 | 3300027578 | Freshwater | MTRAITVKVATTKVIKALETRLATLEKDYSSQEAKEAKYQKAVEAWRKEIGKWAI |
| Ga0209651_10741494 | 3300027581 | Freshwater Lake | MTRAITVKVATTKVIKALETRLATLEKDYASQEAKEAKYQKAVEAW |
| Ga0209651_10807894 | 3300027581 | Freshwater Lake | MSRQITVKVATTKVIKALETRLATLEKDYASQSEKEAKFQKAVEAWR |
| Ga0255079_10075508 | 3300027601 | Freshwater | MTRAITVKVATTKVIKALETRLATLEKDYASQSEKEAKFQKSVEAWRKEI |
| Ga0209769_11682341 | 3300027679 | Freshwater Lake | MSRAITVKVATPKVIKALETRLAELEKTYASQEANEAKFE |
| Ga0209033_11430391 | 3300027697 | Freshwater Lake | MSRQITVKVATSKVIKALEARLATLENDYNTQTAK |
| Ga0209084_12823231 | 3300027749 | Freshwater Lake | MSRAITVKVATPKVIKALETKLATLKADKENEASNEAKYQKAM |
| Ga0209596_10892265 | 3300027754 | Freshwater Lake | MSSRAITVKVAVVKVIKALEARLAELETNYSSQEAKEAKYQ |
| Ga0209444_100952555 | 3300027756 | Freshwater Lake | MSRAITVKVATPKVIKALETRLATLEKDYASQAVNEAKFQKA |
| Ga0209088_101335474 | 3300027763 | Freshwater Lake | MTRAITVKVATTKVIKALETRLATLEKDYASQSEKEAKFQKAVE |
| Ga0209088_101343924 | 3300027763 | Freshwater Lake | MSRAITVKVATPKVIKALETRLATLEKDYASQAVNEAKFEKAREAWRKEIGK |
| Ga0209086_101504691 | 3300027770 | Freshwater Lake | MSRQITVKVATTKVIKALETRLATLEKDYATQGANEAKYNKAVEAWRKE |
| Ga0209550_105224073 | 3300027892 | Freshwater Lake | MSRQITVKVATTKVIKALETRLATLEKDYASQSEKEAK |
| Ga0209299_11676833 | 3300027974 | Freshwater Lake | MSKAITVKVATPKVIKALEARLVRLEKEYSSQEALEAKYQKAIEKWRKEVSKWA |
| Ga0247723_10267221 | 3300028025 | Deep Subsurface Sediment | MSRQITVKVATTKVIKALEARLATLEKDYSSQEANE |
| Ga0247723_10325461 | 3300028025 | Deep Subsurface Sediment | MSRQITVKVATTKVIKALETRLATLEKDYATQGANEAKYQKAVEAWRK |
| Ga0247723_10397381 | 3300028025 | Deep Subsurface Sediment | MARAITVKVATPKVIKALETKLATLESQMANQEKVEAKYQKEYEKYRKSLTDYAIA |
| Ga0315899_1017808810 | 3300031784 | Freshwater | MSRAITVKVATPKVIKALETKLATIKKDYAEQGANEAK |
| Ga0315899_103178871 | 3300031784 | Freshwater | MSRQITVKVATTKVIKALENRLAELEKNYATQGANEAKFQKAQEAWRKEIGKWAMTKFSK |
| Ga0315901_104321111 | 3300031963 | Freshwater | MSRQITVKVATTKVIKALETRLAKLEKDYADQTANEAKHTKAYEAWKKEVGKWAIANFS |
| Ga0315906_103145571 | 3300032050 | Freshwater | MARGKAINVKIATEKVIKALETRLAKLEKDYATQEENEAKFQKSIEKWKKELGKFA |
| Ga0315902_112859561 | 3300032093 | Freshwater | MTKAITVKVATPKVIKALETRLETLERDYASQAEKEAKYQKARENWQKEIGKWA |
| Ga0334977_0194093_1_162 | 3300033978 | Freshwater | MSRQITVKVATTKVIKALEATLAKLENDYNTQAQKEAKFGKAQEAWRKEIGKWA |
| Ga0334977_0194398_1_162 | 3300033978 | Freshwater | MSRQITVKVATSKVIKALEATLAKLENDYNTQAQKEAKFGKAQEAWRKEIGKWA |
| Ga0334982_0061257_1896_2051 | 3300033981 | Freshwater | MSRQITVKVATTKVIKALEATLAKLENDYNTQAQKEAKFGKAQEAWRKEIGK |
| Ga0335003_0254893_674_808 | 3300033995 | Freshwater | MSRQITVKVATTKVIKALETRLATLEKDYASQSEKEAKYQKSVEA |
| Ga0335002_0070030_2284_2463 | 3300034020 | Freshwater | MSRQITVKVATTKVIKALEARLATLENDYNTQTAKEAKFGKAQEAWRKEIGKWAIANFSK |
| ⦗Top⦘ |