| Basic Information | |
|---|---|
| Taxon OID | 3300033817 Open in IMG/M |
| Scaffold ID | Ga0373875_025433 Open in IMG/M |
| Source Dataset Name | Laboratory-enriched microbial communities from a contaminated site in Ontario, Canada - KB1_TCB MSP |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | Beijing Genomics Institute (BGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 826 |
| Total Scaffold Genes | 2 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → Thermotogae → Thermotogae | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Engineered → Bioremediation → Persistent Organic Pollutants (Pop) → Unclassified → Unclassified → Anaerobic Enrichment Culture → Metagenomes From 1,2,4-Trichlorobenzene Dechlorinating Enrichment Cultures |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | University of Toronto, Ontario, Canada | |||||||
| Coordinates | Lat. (o) | 43.65699737 | Long. (o) | -79.3957 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F070782 | Metagenome / Metatranscriptome | 122 | N |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0373875_025433_673_825 | F070782 | N/A | QSDVVYEVNDKVNWAGVNILDRDAEETTEAIHSSVHLDFTLARVDKKYPN |
| ⦗Top⦘ |