Scaffold Ga0326759_02285

Overview

Basic Information

• Taxon OID: 3300033781
• Scaffold ID: Ga0326759_02285
• Source Dataset Name: Hot spring water microbial communities from Geyser Creek Basin, Yellowstone National Park, WY, United States - GCR.JH_P
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 2256
• Total Scaffold Genes: 5
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (20.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Archaea → Asgard group → Candidatus Thorarchaeota → Candidatus Thorarchaeota archaeon (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Thermal Springs → Unclassified → Unclassified → Hot Spring Water → Hot Spring Microbial Communities From Different Geyser Basins In Yellowstone National Park, Wy, United States

Source Dataset Sampling Location

• Location Name: USA: Wyoming
• Coordinates
  • Lat. (^o): 44.6903
  • Long. (^o): -110.7293

Associated Families

Family	Category	Number of Sequences	3D Structure?
F013613	Metagenome / Metatranscriptome	269	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0326759_02285_3_389	F013613	N/A	KGKNISEVAYELIKRGLEANGASAADPPEDALQGALKSLEPLERERVLQFIRELEEAEAELARLGPEAVRQARAMRLTSPELMNLDKKVRLLRHTYEKTIKKSVRSPEVLDVIGERLLRLMKELGIPV