Scaffold Ga0373396_062638

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0373396_062638

Scaffold Ga0373396_062638

Overview

Basic Information
Taxon OID	3300033752 Open in IMG/M
Scaffold ID	Ga0373396_062638 Open in IMG/M
Source Dataset Name	WT metagenomes combined assembly
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	950
Total Scaffold Genes	3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	1 (33.33%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Plant Biomass → Lab Enriched Sorghum-Adapted Microbial Communities From Joint Bioenergy Institute, Emeryville, California, United States

Source Dataset Sampling Location
Location Name	USA: Emeryville, California
Coordinates	Lat. (^o)	37.8406	Long. (^o)	-122.2901	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F014187	Metagenome	265	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0373396_062638_166_381	F014187	GGAG	VRIEQTRANVFTVVATGQELAALVAGARMSLDVMRRAPQPPPAEAVETLERVLRDFDRARGRLGGDDPPAG

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.