Basic Information | |
---|---|
IMG/M Taxon OID | 3300033752 Open in IMG/M |
GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0135754 | Gp0325893 | Ga0373396 |
Sample Name | WT metagenomes combined assembly |
Sequencing Status | Permanent Draft |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Published? | N |
Use Policy | Open |
Dataset Contents | |
---|---|
Total Genome Size | 438838924 |
Sequencing Scaffolds | 2 |
Novel Protein Genes | 2 |
Associated Families | 2 |
Dataset Phylogeny | |
---|---|
Taxonomy Groups | Number of Scaffolds |
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1 |
Not Available | 1 |
Ecosystem Assignment (GOLD) | |
---|---|
Name | Lab Enriched Sorghum-Adapted Microbial Communities From Joint Bioenergy Institute, Emeryville, California, United States |
Type | Host-Associated |
Taxonomy | Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Plant Biomass → Lab Enriched Sorghum-Adapted Microbial Communities From Joint Bioenergy Institute, Emeryville, California, United States |
Alternative Ecosystem Assignments | |
---|---|
Environment Ontology (ENVO) | Unclassified |
Earth Microbiome Project Ontology (EMPO) | Unclassified |
Location Information | ||||||||
---|---|---|---|---|---|---|---|---|
Location | USA: Emeryville, California | |||||||
Coordinates | Lat. (o) | 37.8406 | Long. (o) | -122.2901 | Alt. (m) | N/A | Depth (m) | N/A | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F014042 | Metagenome / Metatranscriptome | 266 | Y |
F014187 | Metagenome | 265 | Y |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
Ga0373396_003720 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 16507 | Open in IMG/M |
Ga0373396_062638 | Not Available | 950 | Open in IMG/M |
Scaffold ID | Protein ID | Family | Sequence |
---|---|---|---|
Ga0373396_003720 | Ga0373396_003720_3745_3912 | F014042 | MRDVGYVAAGYAVALVMLGAYRWRLAVRTRRARRYLSTATGRTGPATGRTGAGWR |
Ga0373396_062638 | Ga0373396_062638_166_381 | F014187 | VRIEQTRANVFTVVATGQELAALVAGARMSLDVMRRAPQPPPAEAVETLERVLRDFDRARGRLGGDDPPAG |
⦗Top⦘ |