NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300033752

3300033752: WT metagenomes combined assembly



Overview

Basic Information
IMG/M Taxon OID3300033752 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0135754 | Gp0325893 | Ga0373396
Sample NameWT metagenomes combined assembly
Sequencing StatusPermanent Draft
Sequencing CenterDOE Joint Genome Institute (JGI)
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size438838924
Sequencing Scaffolds2
Novel Protein Genes2
Associated Families2

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1
Not Available1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameLab Enriched Sorghum-Adapted Microbial Communities From Joint Bioenergy Institute, Emeryville, California, United States
TypeHost-Associated
TaxonomyHost-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Plant Biomass → Lab Enriched Sorghum-Adapted Microbial Communities From Joint Bioenergy Institute, Emeryville, California, United States

Alternative Ecosystem Assignments
Environment Ontology (ENVO)Unclassified
Earth Microbiome Project Ontology (EMPO)Unclassified

Location Information
LocationUSA: Emeryville, California
CoordinatesLat. (o)37.8406Long. (o)-122.2901Alt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F014042Metagenome / Metatranscriptome266Y
F014187Metagenome265Y

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0373396_003720All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia16507Open in IMG/M
Ga0373396_062638Not Available950Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0373396_003720Ga0373396_003720_3745_3912F014042MRDVGYVAAGYAVALVMLGAYRWRLAVRTRRARRYLSTATGRTGPATGRTGAGWR
Ga0373396_062638Ga0373396_062638_166_381F014187VRIEQTRANVFTVVATGQELAALVAGARMSLDVMRRAPQPPPAEAVETLERVLRDFDRARGRLGGDDPPAG

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.