| Basic Information | |
|---|---|
| Taxon OID | 3300033555 Open in IMG/M |
| Scaffold ID | Ga0326733_1036887 Open in IMG/M |
| Source Dataset Name | Glacier ice microbial communities from Ngari, Tibet, China - 14_GP2_30.8 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 1325 |
| Total Scaffold Genes | 3 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (33.33%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | (Source: IMG/M) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Freshwater → Ice → Glacier → Ice → Extreme Environments Viral Communities From Various Locations |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | China: Ngari, Tibet | |||||||
| Coordinates | Lat. (o) | 35.2833 | Long. (o) | 81.4833 | Alt. (m) | Depth (m) | 30 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F104558 | Metagenome / Metatranscriptome | 100 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0326733_10368872 | F104558 | AGGAGG | MTVPSLHVLSTWPDEPAFHLADPRRRTSMEVDLGATWRWAGSNDAWRLAWVRETGELYLCRADAYDGGCSDVAVLAVLHHECDVDALVDGWRERRTDPDGLAWLARRTGLRVA |
| ⦗Top⦘ |