Basic Information | |
---|---|
Taxon OID | 3300033494 Open in IMG/M |
Scaffold ID | Ga0316612_1091426 Open in IMG/M |
Source Dataset Name | Microbial mat bacterial communities from Middle Island sinkhole, Lake Huron, Michigan, United States - MIS.2016.226 |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 682 |
Total Scaffold Genes | 1 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Freshwater → Lake → Sediment → Microbial Mat → Microbial Communities From Sediments And Microbial Mats In Various Locations |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | USA: Michigan | |||||||
Coordinates | Lat. (o) | 45.1993 | Long. (o) | -83.3279 | Alt. (m) | Depth (m) | 185 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F088111 | Metagenome / Metatranscriptome | 109 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0316612_10914261 | F088111 | N/A | SSYGFLLVNQQAYQNVFSENPTNGPTGYDHLTYSFSSPAGNSFFAILDPYYVNKDTVKEGLGGNIDSTQMSWLKNQVAKTTATHKFLFIHTPYYYVFSDTNELAEANQSFTNLWAFLDAKKFDIYACEHSHLFARRTIDSSILPNPPTTPPTPLWQNNVVQLLNGTCGADPSTGYIDPDFKASWNVHNDAQTFYFSVVDIKGSTVTVNSYSGSTGAYSVFDTFSVTR |
⦗Top⦘ |