Scaffold Ga0316612_1091426

Overview

Basic Information

• Taxon OID: 3300033494
• Scaffold ID: Ga0316612_1091426
• Source Dataset Name: Microbial mat bacterial communities from Middle Island sinkhole, Lake Huron, Michigan, United States - MIS.2016.226
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 682
• Total Scaffold Genes: 1
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Freshwater → Lake → Sediment → Microbial Mat → Microbial Communities From Sediments And Microbial Mats In Various Locations

Source Dataset Sampling Location

• Location Name: USA: Michigan
• Coordinates
  • Lat. (^o): 45.1993
  • Long. (^o): -83.3279
  • Depth (m): 185

Associated Families

Family	Category	Number of Sequences	3D Structure?
F088111	Metagenome / Metatranscriptome	109	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0316612_10914261	F088111	N/A	SSYGFLLVNQQAYQNVFSENPTNGPTGYDHLTYSFSSPAGNSFFAILDPYYVNKDTVKEGLGGNIDSTQMSWLKNQVAKTTATHKFLFIHTPYYYVFSDTNELAEANQSFTNLWAFLDAKKFDIYACEHSHLFARRTIDSSILPNPPTTPPTPLWQNNVVQLLNGTCGADPSTGYIDPDFKASWNVHNDAQTFYFSVVDIKGSTVTVNSYSGSTGAYSVFDTFSVTR