Scaffold Ga0316611_1033778

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0316611_1033778

Scaffold Ga0316611_1033778

Overview

Basic Information
Taxon OID	3300033446 Open in IMG/M
Scaffold ID	Ga0316611_1033778 Open in IMG/M
Source Dataset Name	Microbial mat bacterial communities from Middle Island sinkhole, Lake Huron, Michigan, United States - MIS.2016.202
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	1473
Total Scaffold Genes	6 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lake → Sediment → Microbial Mat → Microbial Communities From Sediments And Microbial Mats In Various Locations

Source Dataset Sampling Location
Location Name	USA: Michigan
Coordinates	Lat. (^o)	45.1993	Long. (^o)	-83.3279	Alt. (m)		Depth (m)	185
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F095378	Metagenome	105	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0316611_10337783	F095378	N/A	MKAILIDELVKYQSTTEQVSVTIEGKKLEGWEIAKPLNYEKKYTRFTDRLKSSIKVLTGKAIAVQFFTDLTEQDKIAYVKTKLN

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.