NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0316611_1033778

Scaffold Ga0316611_1033778


Overview

Basic Information
Taxon OID3300033446 Open in IMG/M
Scaffold IDGa0316611_1033778 Open in IMG/M
Source Dataset NameMicrobial mat bacterial communities from Middle Island sinkhole, Lake Huron, Michigan, United States - MIS.2016.202
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1473
Total Scaffold Genes6 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lake → Sediment → Microbial Mat → Microbial Communities From Sediments And Microbial Mats In Various Locations

Source Dataset Sampling Location
Location NameUSA: Michigan
CoordinatesLat. (o)45.1993Long. (o)-83.3279Alt. (m)Depth (m)185
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F095378Metagenome105Y

Sequences

Protein IDFamilyRBSSequence
Ga0316611_10337783F095378N/AMKAILIDELVKYQSTTEQVSVTIEGKKLEGWEIAKPLNYEKKYTRFTDRLKSSIKVLTGKAIAVQFFTDLTEQDKIAYVKTKLN

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.