Scaffold Ga0316603_10097569

Overview

Basic Information

• Taxon OID: 3300033413
• Scaffold ID: Ga0316603_10097569
• Source Dataset Name: Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day10_noCT
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 2311
• Total Scaffold Genes: 5
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 4 (80.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium ADurb.Bin180 (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil → Wetland Soil Microbial Communities From Various Locations

Source Dataset Sampling Location

• Location Name: USA: Ohio
• Coordinates
  • Lat. (^o): 41.3777
  • Long. (^o): -82.5117
  • Depth (m): 0

Associated Families

Family	Category	Number of Sequences	3D Structure?
F048394	Metagenome / Metatranscriptome	148	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0316603_100975692	F048394	AGG	MNGPLLISLLPPEQIGEAAKAPPGEVPYVVAILLLAGILLSLWMRPPGR