NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0334884_1130313

Scaffold Ga0334884_1130313


Overview

Basic Information
Taxon OID3300033170 Open in IMG/M
Scaffold IDGa0334884_1130313 Open in IMG/M
Source Dataset NameSludge microbial communities from methane-producing bioreactor in Wageningen University, Netherlands - Granular Sludge_12_05 R1
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)753
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria → Atribacterota → unclassified Atribacterota → Candidatus Atribacteria bacterium ADurb.Bin276(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Engineered → Bioreactor → Anaerobic → Unclassified → Unclassified → Sludge → Sludge Microbial Communities From Methane-Producing Bioreactor In Wageningen University, Netherlands

Source Dataset Sampling Location
Location NameNetherlands: Wageningen, Gelderland
CoordinatesLat. (o)51.9691Long. (o)5.6654Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F059692Metagenome / Metatranscriptome133N
F099347Metagenome / Metatranscriptome103N

Sequences

Protein IDFamilyRBSSequence
Ga0334884_11303131F059692N/ADKETEQLILKKLQLDYLSLHAILTDVEKIISALVVDLDPRVNEIQRIQDQIRVYLREP
Ga0334884_11303133F099347AGGMNLADFIENFEAFITYIEEAWEQKDLEILKAIVSDCEDFIHSHGHQFKCYSQTVKEWKETYRKNREERKEIVKGICEWCGRKKGTNCHHLAKRGRLVLYNDVRLLRILCADCHRLFHS

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.