Scaffold Ga0316227_1000686

Overview

Basic Information

• Taxon OID: 3300032677
• Scaffold ID: Ga0316227_1000686
• Source Dataset Name: Freshwater microbial communities from Trout Bog Lake, Wisconsin, USA - TBH18019
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 44645
• Total Scaffold Genes: 57
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 23 (40.35%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102 (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Freshwater → Lentic → Hypolimnion → Freshwater → Microbial Communities From Trout Bog Lake Hypolimnion, Wisconsin, Usa

Source Dataset Sampling Location

• Location Name: USA: Wisconsin
• Coordinates
  • Lat. (^o): 46.0411
  • Long. (^o): -89.6861

Associated Families

Family	Category	Number of Sequences	3D Structure?
F080806	Metagenome / Metatranscriptome	114	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0316227_10006864	F080806	N/A	MHHLDTAATGAIGFTAPIAAAAISLDPMLDLELRVASMIIGILVGLASFAKLAYDLYADHKNRNK