Scaffold Ga0352977_1040518

Overview

Basic Information

• Taxon OID: 3300032599
• Scaffold ID: Ga0352977_1040518
• Source Dataset Name: Metatranscriptome of Cow rumen microbial communities from the University of Illinois at Urbana-Champaign, USA - Cow X-1 switchgrass (Eukaryote Metatranscriptome)
• Source Dataset Category: Metatranscriptome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 540
• Total Scaffold Genes: 1
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: Not Available (Source: )

Ecosystem & Geography

Source Dataset Ecosystem: Host-Associated → Mammals → Digestive System → Foregut → Unclassified → Fungi-Associated Bovine Rumen → Fungi-Associated Bovine Rumen Microbial Communities From The University Of Illinois At Urbana-Champaign, Usa, For Metatranscriptome Analysis

Source Dataset Sampling Location

• Location Name: USA: Illinois
• Coordinates
  • Lat. (^o): 40.102108
  • Long. (^o): -88.227299

Associated Families

Family	Category	Number of Sequences	3D Structure?
F004661	Metagenome / Metatranscriptome	428	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0352977_10405181	F004661	N/A	PENFVQRAGELEIAGLERPENLVQHTGEIVLEAKDRPENVFEQRDAIEILGMEKEPLQLQPINQLFIAAVPRPENFVQRAGELEIAGLERPENIVQHSGELEIAALERPENVFEQRDAIEILGMEKEPLQLQPINQLFIAAVPRPENFVQHIDEVELVAKDRPENIVQQTNEIVLEARD