NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0316222_1092240

Scaffold Ga0316222_1092240


Overview

Basic Information
Taxon OID3300032561 Open in IMG/M
Scaffold IDGa0316222_1092240 Open in IMG/M
Source Dataset NameFreshwater microbial communities from Trout Bog Lake, Wisconsin, USA - TBH18011
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1230
Total Scaffold Genes4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (50.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lentic → Hypolimnion → Freshwater → Microbial Communities From Trout Bog Lake Hypolimnion, Wisconsin, Usa

Source Dataset Sampling Location
Location NameUSA: Wisconsin
CoordinatesLat. (o)46.0411Long. (o)-89.6861Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F038203Metagenome / Metatranscriptome166Y

Sequences

Protein IDFamilyRBSSequence
Ga0316222_10922401F038203N/ASNSSPYASYPVIQQAGLMILTHLYNNRSDTTSMNLKQIPMGAAALLRPYKPLVL

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.