| Basic Information | |
|---|---|
| Family ID | F038203 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 166 |
| Average Sequence Length | 47 residues |
| Representative Sequence | PVIKQAGLLLLTHLYNNRSDTTETKLKTIPFGVQALLRPYKPLVM |
| Number of Associated Samples | 144 |
| Number of Associated Scaffolds | 166 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Viruses |
| % of genes with valid RBS motifs | 0.60 % |
| % of genes near scaffold ends (potentially truncated) | 98.19 % |
| % of genes from short scaffolds (< 2000 bps) | 83.13 % |
| Associated GOLD sequencing projects | 137 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.32 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Duplodnaviria (93.373 % of family members) |
| NCBI Taxonomy ID | 2731341 |
| Taxonomy | All Organisms → Viruses → Duplodnaviria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater (17.470 % of family members) |
| Environment Ontology (ENVO) | Unclassified (57.831 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (64.458 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 50.68% β-sheet: 0.00% Coil/Unstructured: 49.32% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.32 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 166 Family Scaffolds |
|---|---|---|
| PF05135 | Phage_connect_1 | 6.02 |
| PF04883 | HK97-gp10_like | 3.01 |
| PF09718 | Tape_meas_lam_C | 2.41 |
| PF07460 | NUMOD3 | 0.60 |
| PF05772 | NinB | 0.60 |
| PF05521 | Phage_H_T_join | 0.60 |
| PF05065 | Phage_capsid | 0.60 |
| COG ID | Name | Functional Category | % Frequency in 166 Family Scaffolds |
|---|---|---|---|
| COG4653 | Predicted phage phi-C31 gp36 major capsid-like protein | Mobilome: prophages, transposons [X] | 0.60 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 99.40 % |
| Unclassified | root | N/A | 0.60 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000032|Draft_c0413054 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 541 | Open in IMG/M |
| 3300000176|TB03JUN2009E_c044653 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 578 | Open in IMG/M |
| 3300000203|TB18AUG2009E_c000573 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 6922 | Open in IMG/M |
| 3300001097|JGIcombinedJ13537_10001954 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 8455 | Open in IMG/M |
| 3300001836|RCM27_1093656 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 517 | Open in IMG/M |
| 3300001838|RCM33_1021147 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 826 | Open in IMG/M |
| 3300001839|RCM40_1059216 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 659 | Open in IMG/M |
| 3300001842|RCM30_1103588 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 823 | Open in IMG/M |
| 3300001851|RCM31_10356853 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 663 | Open in IMG/M |
| 3300002092|JGI24218J26658_1002852 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4219 | Open in IMG/M |
| 3300002212|metazooDRAFT_1346648 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 543 | Open in IMG/M |
| 3300002220|MLSBCLC_10222407 | All Organisms → Viruses → Predicted Viral | 1371 | Open in IMG/M |
| 3300003394|JGI25907J50239_1004912 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3233 | Open in IMG/M |
| 3300003411|JGI25911J50253_10067010 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1172 | Open in IMG/M |
| 3300003413|JGI25922J50271_10003370 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4586 | Open in IMG/M |
| 3300003430|JGI25921J50272_10043171 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1054 | Open in IMG/M |
| 3300003806|Ga0007864_1005828 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1037 | Open in IMG/M |
| 3300003813|Ga0007879_1017579 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 749 | Open in IMG/M |
| 3300003820|Ga0007863_1001193 | All Organisms → Viruses → Predicted Viral | 3542 | Open in IMG/M |
| 3300003852|Ga0031655_10119719 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1045 | Open in IMG/M |
| 3300004240|Ga0007787_10194085 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 987 | Open in IMG/M |
| 3300004282|Ga0066599_101618785 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 502 | Open in IMG/M |
| 3300004481|Ga0069718_14632721 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 599 | Open in IMG/M |
| 3300004686|Ga0065173_1077607 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 598 | Open in IMG/M |
| 3300004692|Ga0065171_1016219 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1193 | Open in IMG/M |
| 3300004770|Ga0007804_1096620 | All Organisms → cellular organisms → Bacteria | 753 | Open in IMG/M |
| 3300004770|Ga0007804_1186065 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 516 | Open in IMG/M |
| 3300004774|Ga0007794_10210571 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 578 | Open in IMG/M |
| 3300005582|Ga0049080_10080749 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1112 | Open in IMG/M |
| 3300005584|Ga0049082_10266109 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 577 | Open in IMG/M |
| 3300005914|Ga0075117_1110802 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 809 | Open in IMG/M |
| 3300006101|Ga0007810_1104498 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 542 | Open in IMG/M |
| 3300006108|Ga0007862_1084266 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 609 | Open in IMG/M |
| 3300006117|Ga0007818_1010536 | All Organisms → Viruses → Predicted Viral | 1927 | Open in IMG/M |
| 3300006124|Ga0007873_1022953 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1038 | Open in IMG/M |
| 3300006128|Ga0007828_1104141 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 586 | Open in IMG/M |
| 3300006641|Ga0075471_10594518 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 543 | Open in IMG/M |
| 3300006803|Ga0075467_10463649 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 654 | Open in IMG/M |
| 3300006805|Ga0075464_10331108 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 919 | Open in IMG/M |
| 3300006917|Ga0075472_10263603 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 849 | Open in IMG/M |
| 3300006917|Ga0075472_10671901 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 521 | Open in IMG/M |
| 3300007559|Ga0102828_1052857 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 947 | Open in IMG/M |
| 3300007708|Ga0102859_1133996 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 723 | Open in IMG/M |
| 3300007973|Ga0105746_1069660 | All Organisms → Viruses → Predicted Viral | 1127 | Open in IMG/M |
| 3300008055|Ga0108970_11700576 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 675 | Open in IMG/M |
| 3300008113|Ga0114346_1147030 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1515 | Open in IMG/M |
| 3300008116|Ga0114350_1066469 | All Organisms → Viruses → Predicted Viral | 1246 | Open in IMG/M |
| 3300008267|Ga0114364_1165354 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 587 | Open in IMG/M |
| 3300008450|Ga0114880_1100572 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1118 | Open in IMG/M |
| 3300008450|Ga0114880_1155856 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 817 | Open in IMG/M |
| 3300008996|Ga0102831_1193555 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 673 | Open in IMG/M |
| 3300009026|Ga0102829_1043475 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1337 | Open in IMG/M |
| 3300009085|Ga0105103_10209623 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1044 | Open in IMG/M |
| 3300009085|Ga0105103_10835314 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 536 | Open in IMG/M |
| 3300009155|Ga0114968_10179327 | All Organisms → Viruses → Predicted Viral | 1239 | Open in IMG/M |
| 3300009169|Ga0105097_10013948 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 4182 | Open in IMG/M |
| 3300009169|Ga0105097_10038796 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 2556 | Open in IMG/M |
| 3300009183|Ga0114974_10280270 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 987 | Open in IMG/M |
| 3300009183|Ga0114974_10415337 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 768 | Open in IMG/M |
| 3300010158|Ga0114960_10098412 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1632 | Open in IMG/M |
| 3300010354|Ga0129333_11551832 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 541 | Open in IMG/M |
| 3300010354|Ga0129333_11738885 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 506 | Open in IMG/M |
| 3300010885|Ga0133913_10968331 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 2203 | Open in IMG/M |
| 3300010885|Ga0133913_12558106 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1241 | Open in IMG/M |
| 3300010885|Ga0133913_13314409 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1059 | Open in IMG/M |
| 3300010966|Ga0137675_1015109 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 622 | Open in IMG/M |
| 3300010970|Ga0137575_10014113 | All Organisms → Viruses → Predicted Viral | 1348 | Open in IMG/M |
| 3300011010|Ga0139557_1033866 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 897 | Open in IMG/M |
| 3300012013|Ga0153805_1023129 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1058 | Open in IMG/M |
| 3300012666|Ga0157498_1003150 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 2784 | Open in IMG/M |
| 3300012666|Ga0157498_1072672 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 530 | Open in IMG/M |
| 3300013005|Ga0164292_10015374 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 6262 | Open in IMG/M |
| 3300013014|Ga0164295_10015028 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5979 | Open in IMG/M |
| 3300013093|Ga0164296_1375190 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 528 | Open in IMG/M |
| 3300014711|Ga0134314_101023 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 2332 | Open in IMG/M |
| 3300017736|Ga0181365_1067198 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 886 | Open in IMG/M |
| 3300017754|Ga0181344_1049438 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1256 | Open in IMG/M |
| 3300017785|Ga0181355_1119220 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1081 | Open in IMG/M |
| 3300019784|Ga0181359_1011926 | All Organisms → Viruses → Predicted Viral | 3132 | Open in IMG/M |
| 3300020141|Ga0211732_1522876 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1532 | Open in IMG/M |
| 3300020160|Ga0211733_10596721 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 638 | Open in IMG/M |
| 3300020162|Ga0211735_10958703 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 673 | Open in IMG/M |
| 3300020183|Ga0194115_10245182 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 851 | Open in IMG/M |
| 3300020205|Ga0211731_10084930 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 559 | Open in IMG/M |
| 3300020570|Ga0208465_1037554 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 619 | Open in IMG/M |
| 3300020697|Ga0214230_126041 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 645 | Open in IMG/M |
| 3300020715|Ga0214254_1015681 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1087 | Open in IMG/M |
| 3300020717|Ga0214248_1015887 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1131 | Open in IMG/M |
| 3300020718|Ga0214178_1002209 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4127 | Open in IMG/M |
| 3300020724|Ga0214244_1042343 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 631 | Open in IMG/M |
| 3300020727|Ga0214246_1014135 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1418 | Open in IMG/M |
| 3300020732|Ga0214201_1002809 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4767 | Open in IMG/M |
| 3300020732|Ga0214201_1056158 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 566 | Open in IMG/M |
| 3300020735|Ga0214219_1019407 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1137 | Open in IMG/M |
| 3300021125|Ga0214211_1002922 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2031 | Open in IMG/M |
| 3300021127|Ga0214193_1003364 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 2628 | Open in IMG/M |
| 3300021138|Ga0214164_1104038 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 530 | Open in IMG/M |
| 3300021142|Ga0214192_1049296 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1311 | Open in IMG/M |
| 3300021956|Ga0213922_1037482 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1129 | Open in IMG/M |
| 3300021956|Ga0213922_1084141 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 658 | Open in IMG/M |
| 3300021956|Ga0213922_1126183 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 501 | Open in IMG/M |
| 3300021962|Ga0222713_10383395 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 870 | Open in IMG/M |
| 3300022053|Ga0212030_1013456 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1046 | Open in IMG/M |
| 3300022179|Ga0181353_1019185 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1791 | Open in IMG/M |
| 3300022591|Ga0236341_1048669 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1098 | Open in IMG/M |
| 3300022867|Ga0222629_1011167 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1365 | Open in IMG/M |
| 3300022927|Ga0255769_10212291 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 846 | Open in IMG/M |
| 3300023235|Ga0222634_1028340 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 914 | Open in IMG/M |
| 3300023501|Ga0222686_1014066 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1247 | Open in IMG/M |
| 3300024346|Ga0244775_10616146 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 880 | Open in IMG/M |
| 3300024346|Ga0244775_10957775 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 677 | Open in IMG/M |
| 3300024346|Ga0244775_11534600 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 508 | Open in IMG/M |
| 3300024496|Ga0255151_1062114 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 603 | Open in IMG/M |
| 3300024500|Ga0255143_1087164 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 500 | Open in IMG/M |
| 3300024505|Ga0255150_1042538 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 737 | Open in IMG/M |
| 3300025368|Ga0208620_1008698 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1278 | Open in IMG/M |
| 3300025391|Ga0208740_1002063 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4152 | Open in IMG/M |
| 3300025398|Ga0208251_1067341 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 544 | Open in IMG/M |
| 3300025400|Ga0208387_1049603 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 661 | Open in IMG/M |
| 3300025407|Ga0208378_1039762 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 784 | Open in IMG/M |
| 3300025416|Ga0208877_1017607 | All Organisms → Viruses → Predicted Viral | 1262 | Open in IMG/M |
| 3300025416|Ga0208877_1067043 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 566 | Open in IMG/M |
| 3300025421|Ga0207958_1012889 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1474 | Open in IMG/M |
| 3300025430|Ga0208622_1039449 | Not Available | 883 | Open in IMG/M |
| 3300025437|Ga0208742_1084185 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 505 | Open in IMG/M |
| 3300025466|Ga0208497_1002707 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 6119 | Open in IMG/M |
| 3300025466|Ga0208497_1057256 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 767 | Open in IMG/M |
| 3300025598|Ga0208379_1036624 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1322 | Open in IMG/M |
| 3300025645|Ga0208643_1014387 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 2917 | Open in IMG/M |
| 3300025723|Ga0208741_10013382 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 2134 | Open in IMG/M |
| 3300025723|Ga0208741_10032035 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1239 | Open in IMG/M |
| 3300025783|Ga0208258_1008017 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1758 | Open in IMG/M |
| 3300025896|Ga0208916_10355281 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 639 | Open in IMG/M |
| 3300025896|Ga0208916_10394140 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 604 | Open in IMG/M |
| 3300026455|Ga0255155_1001927 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3951 | Open in IMG/M |
| 3300027508|Ga0255072_1081839 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 645 | Open in IMG/M |
| 3300027693|Ga0209704_1112921 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 777 | Open in IMG/M |
| 3300027734|Ga0209087_1004592 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 7485 | Open in IMG/M |
| 3300027736|Ga0209190_1349442 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 547 | Open in IMG/M |
| 3300027804|Ga0209358_10216611 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 982 | Open in IMG/M |
| 3300027805|Ga0209229_10087355 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1402 | Open in IMG/M |
| 3300027896|Ga0209777_10200952 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1602 | Open in IMG/M |
| 3300027896|Ga0209777_10810207 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 656 | Open in IMG/M |
| 3300028108|Ga0256305_1142477 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 571 | Open in IMG/M |
| 3300031759|Ga0316219_1233709 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 648 | Open in IMG/M |
| 3300031857|Ga0315909_10916806 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 539 | Open in IMG/M |
| 3300031885|Ga0315285_10191323 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1644 | Open in IMG/M |
| 3300031999|Ga0315274_10691923 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1104 | Open in IMG/M |
| 3300032093|Ga0315902_10192189 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 2062 | Open in IMG/M |
| 3300032116|Ga0315903_10002445 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 27290 | Open in IMG/M |
| 3300032275|Ga0315270_11116452 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 524 | Open in IMG/M |
| 3300032561|Ga0316222_1092240 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1230 | Open in IMG/M |
| 3300032561|Ga0316222_1116541 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1040 | Open in IMG/M |
| 3300032561|Ga0316222_1116787 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1038 | Open in IMG/M |
| 3300032562|Ga0316226_1342035 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 561 | Open in IMG/M |
| 3300032579|Ga0316228_1211788 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 628 | Open in IMG/M |
| 3300032753|Ga0316224_1216344 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 625 | Open in IMG/M |
| 3300034061|Ga0334987_0335341 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 985 | Open in IMG/M |
| 3300034063|Ga0335000_0389444 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 832 | Open in IMG/M |
| 3300034068|Ga0334990_0003134 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 9345 | Open in IMG/M |
| 3300034071|Ga0335028_0240932 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1099 | Open in IMG/M |
| 3300034082|Ga0335020_0137018 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1237 | Open in IMG/M |
| 3300034104|Ga0335031_0608854 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 643 | Open in IMG/M |
| 3300034105|Ga0335035_0487540 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 677 | Open in IMG/M |
| 3300034272|Ga0335049_0713589 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 605 | Open in IMG/M |
| 3300034283|Ga0335007_0049551 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 3243 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater | 17.47% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Hypolimnion → Freshwater | 7.83% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 7.23% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 6.63% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 6.02% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 5.42% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 5.42% |
| Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 3.61% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 3.01% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 3.01% |
| Marine Plankton | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Marine Plankton | 3.01% |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 2.41% |
| Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment | 1.81% |
| Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 1.81% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 1.81% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 1.81% |
| Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 1.81% |
| Freshwater | Environmental → Aquatic → Freshwater → Creek → Unclassified → Freshwater | 1.81% |
| Estuarine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine | 1.81% |
| Saline Water | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Water | 1.81% |
| Freshwater Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic | 1.20% |
| Freshwater, Surface Ice | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Surface Ice | 1.20% |
| Pond Fresh Water | Environmental → Aquatic → Freshwater → Pond → Unclassified → Pond Fresh Water | 1.20% |
| Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 1.20% |
| Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Sediment | 0.60% |
| Lake | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Lake | 0.60% |
| Freshwater And Sediment | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater And Sediment | 0.60% |
| Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Lentic | 0.60% |
| Surface Water | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Surface Water | 0.60% |
| Surface Ice | Environmental → Aquatic → Freshwater → Ice → Unclassified → Surface Ice | 0.60% |
| Freshwater | Environmental → Aquatic → Freshwater → Ice → Unclassified → Freshwater | 0.60% |
| Freshwater | Environmental → Aquatic → Freshwater → Pond → Sediment → Freshwater | 0.60% |
| Estuary Water | Environmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water | 0.60% |
| Salt Marsh | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh | 0.60% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 0.60% |
| Saline Lake | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Lake | 0.60% |
| Hypersaline | Environmental → Aquatic → Non-Marine Saline And Alkaline → Hypersaline → Unclassified → Hypersaline | 0.60% |
| Estuary | Host-Associated → Plants → Leaf → Unclassified → Unclassified → Estuary | 0.60% |
| Hydrocarbon Resource Environments | Engineered → Wastewater → Industrial Wastewater → Petrochemical → Unclassified → Hydrocarbon Resource Environments | 0.60% |
| Hydrocarbon Resource Environments | Engineered → Lab Enrichment → Defined Media → Anaerobic Media → Unclassified → Hydrocarbon Resource Environments | 0.60% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000032 | Oil sands microbial community from Northern Alberta which degrade Naphthaline | Engineered | Open in IMG/M |
| 3300000176 | Freshwater microbial communities from Trout Bog Lake, WI - Practice 03JUN2009 epilimnion | Environmental | Open in IMG/M |
| 3300000203 | Freshwater microbial communities from Trout Bog Lake, WI - Practice 18AUG2009 epilimnion | Environmental | Open in IMG/M |
| 3300001097 | Saline microbial communities from Lake Vida, Antarctica (Lake Vida Brine Hole Two - Combined Assembly 2 samples, Mar 2013 Assem) | Environmental | Open in IMG/M |
| 3300001836 | Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - RCM27, ROCA_DNA191_0.2um_MCP-N_C_3a | Environmental | Open in IMG/M |
| 3300001838 | Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - RCM33, ROCA_DNA217_0.2um_bLM_C_2a | Environmental | Open in IMG/M |
| 3300001839 | Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - RCM40, ROCA_DNA238_2.0um_Ob_C_3b | Environmental | Open in IMG/M |
| 3300001842 | Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - RCM30, ROCA_DNA203_0.2um_MCP-S_C_2b | Environmental | Open in IMG/M |
| 3300001851 | Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - RCM31, ROCA_DNA206_0.2um_MCP-S_C_3b | Environmental | Open in IMG/M |
| 3300002092 | Lentic bog actinobacteria communities from Grosse Fuchskuhle, Germany - Sample acI-B2 co-culture F-B6 metagenome | Environmental | Open in IMG/M |
| 3300002212 | Freshwater microbial communities from San Paulo Zoo lake, Brazil - JAN 2013 | Environmental | Open in IMG/M |
| 3300002220 | Wastewater microbial communities from Syncrude, Ft. McMurray, Alberta - West In Pit SyncrudeMLSB2011 | Engineered | Open in IMG/M |
| 3300003394 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SN | Environmental | Open in IMG/M |
| 3300003411 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.SD | Environmental | Open in IMG/M |
| 3300003413 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.DD | Environmental | Open in IMG/M |
| 3300003430 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD | Environmental | Open in IMG/M |
| 3300003806 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH16Oct07 | Environmental | Open in IMG/M |
| 3300003813 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH15Jun09 | Environmental | Open in IMG/M |
| 3300003820 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH10Sep07 | Environmental | Open in IMG/M |
| 3300003852 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies -HBP12 HB | Environmental | Open in IMG/M |
| 3300004240 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MLB.SN | Environmental | Open in IMG/M |
| 3300004282 | Freshwater pond sediment microbial communities from the University of Edinburgh, under environmental carbon perturbations - Initial sediment | Environmental | Open in IMG/M |
| 3300004481 | Combined Assembly of Gp0112041, Gp0112042, Gp0112043 | Environmental | Open in IMG/M |
| 3300004686 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE10Oct08 (version 2) | Environmental | Open in IMG/M |
| 3300004692 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE27Jun07 (version 2) | Environmental | Open in IMG/M |
| 3300004770 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE25Aug07 | Environmental | Open in IMG/M |
| 3300004774 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - MA5M | Environmental | Open in IMG/M |
| 3300005582 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRF | Environmental | Open in IMG/M |
| 3300005584 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG HU45MSRF | Environmental | Open in IMG/M |
| 3300005914 | Saline lake microbial communities from Ace Lake, Antarctica - Antarctic Ace Lake Metagenome 02UKJ | Environmental | Open in IMG/M |
| 3300006101 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE15Jun09 | Environmental | Open in IMG/M |
| 3300006108 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH20Aug07 | Environmental | Open in IMG/M |
| 3300006117 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE08Jun09 | Environmental | Open in IMG/M |
| 3300006124 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH26May08 | Environmental | Open in IMG/M |
| 3300006128 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE16Oct07 | Environmental | Open in IMG/M |
| 3300006641 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_>0.8_DNA | Environmental | Open in IMG/M |
| 3300006803 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_>0.8_DNA | Environmental | Open in IMG/M |
| 3300006805 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006917 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_<0.8_DNA | Environmental | Open in IMG/M |
| 3300007559 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.541 | Environmental | Open in IMG/M |
| 3300007708 | Estuarine microbial communities from the Columbia River estuary - metaG 1371B-02 | Environmental | Open in IMG/M |
| 3300007973 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1460A_0.2um | Environmental | Open in IMG/M |
| 3300008055 | Metatranscriptomes of the Eelgrass leaves and roots. Combined Assembly of Gp0128390, Gp0128391, Gp0128392, and Gp0128393 | Host-Associated | Open in IMG/M |
| 3300008113 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample E2014-0050-3-NA | Environmental | Open in IMG/M |
| 3300008116 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0106-3-NA | Environmental | Open in IMG/M |
| 3300008267 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, sample HABS-E2014-0024-100-LTR | Environmental | Open in IMG/M |
| 3300008450 | Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - Oct 27, 2014 all contigs | Environmental | Open in IMG/M |
| 3300008996 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.747 | Environmental | Open in IMG/M |
| 3300009026 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.575 | Environmental | Open in IMG/M |
| 3300009085 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 10-12cm September2015 | Environmental | Open in IMG/M |
| 3300009155 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_EF_MetaG | Environmental | Open in IMG/M |
| 3300009169 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm May2015 | Environmental | Open in IMG/M |
| 3300009183 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG | Environmental | Open in IMG/M |
| 3300010158 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130625_MF_MetaG | Environmental | Open in IMG/M |
| 3300010354 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_DNA | Environmental | Open in IMG/M |
| 3300010885 | northern Canada Lakes Co-assembly | Environmental | Open in IMG/M |
| 3300010966 | Freshwater microbial communities from the surface of the forest pond in Jussy, Geneva, Switzerland - JEBV1bis, april 2016 | Environmental | Open in IMG/M |
| 3300010970 | Freshwater microbial communities from the surface of the forest pond in Jussy, Geneva, Switzerland - JEBV1, april 2016 | Environmental | Open in IMG/M |
| 3300011010 | Freshwater microbial communities from Western Basin Lake Erie, Ontario, Canada - Station 970 - Surface Ice | Environmental | Open in IMG/M |
| 3300012013 | Freshwater microbial communities from Eastern Basin Lake Erie, Ontario, Canada - Station 67 - Surface Ice | Environmental | Open in IMG/M |
| 3300012666 | Freshwater microbial communities from Central Basin Lake Erie, Ontario, Canada - Station 1208 - Surface Ice version 2 | Environmental | Open in IMG/M |
| 3300013005 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES117 metaG | Environmental | Open in IMG/M |
| 3300013014 | Oligotrophic lake water microbial communities from Sparkling Lake, Wisconsin, USA - GEODES006 metaG | Environmental | Open in IMG/M |
| 3300013093 | Dystrophic lake water microbial communities from Trout Bog Lake, Wisconsin, USA - GEODES057 metaG | Environmental | Open in IMG/M |
| 3300014711 | Surface water microbial communities from Bangladesh - BaraHaldiaSW0111 | Environmental | Open in IMG/M |
| 3300017736 | Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MM110.D.N | Environmental | Open in IMG/M |
| 3300017754 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MLB.D.D | Environmental | Open in IMG/M |
| 3300017785 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.D.N | Environmental | Open in IMG/M |
| 3300019784 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.D | Environmental | Open in IMG/M |
| 3300020141 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_104 megahit1 | Environmental | Open in IMG/M |
| 3300020160 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_105 megahit1 | Environmental | Open in IMG/M |
| 3300020162 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_201 megahit1 | Environmental | Open in IMG/M |
| 3300020183 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015002 Mahale S4 surface | Environmental | Open in IMG/M |
| 3300020205 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_103 megahit1 | Environmental | Open in IMG/M |
| 3300020570 | Freshwater microbial communities from Lake Mendota, WI - 31AUG2010 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020697 | Freshwater microbial communities from Trout Bog Lake, WI - 22MAY2008 hypolimnion | Environmental | Open in IMG/M |
| 3300020715 | Freshwater microbial communities from Trout Bog Lake, WI - 27JUL2009 hypolimnion | Environmental | Open in IMG/M |
| 3300020717 | Freshwater microbial communities from Trout Bog Lake, WI - 15JUN2009 hypolimnion | Environmental | Open in IMG/M |
| 3300020718 | Freshwater microbial communities from Trout Bog Lake, WI - 17SEP2007 epilimnion | Environmental | Open in IMG/M |
| 3300020724 | Freshwater microbial communities from Trout Bog Lake, WI - 04OCT2008 hypolimnion | Environmental | Open in IMG/M |
| 3300020727 | Freshwater microbial communities from Trout Bog Lake, WI - 29MAY2009 hypolimnion | Environmental | Open in IMG/M |
| 3300020732 | Freshwater microbial communities from Trout Bog Lake, WI - 29MAY2009 epilimnion | Environmental | Open in IMG/M |
| 3300020735 | Freshwater microbial communities from Trout Bog Lake, WI - 25JUL2007 hypolimnion | Environmental | Open in IMG/M |
| 3300021125 | Freshwater microbial communities from Trout Bog Lake, WI - 11AUG2009 epilimnion | Environmental | Open in IMG/M |
| 3300021127 | Freshwater microbial communities from Trout Bog Lake, WI - 05AUG2008 epilimnion | Environmental | Open in IMG/M |
| 3300021138 | Freshwater microbial communities from Trout Bog Lake, WI - Practice 03JUN2009 epilimnion | Environmental | Open in IMG/M |
| 3300021142 | Freshwater microbial communities from Trout Bog Lake, WI - 29JUL2008 epilimnion | Environmental | Open in IMG/M |
| 3300021956 | Freshwater microbial communities from McNutts Creek, Athens, Georgia, United States - 29-17 MG | Environmental | Open in IMG/M |
| 3300021962 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_649D | Environmental | Open in IMG/M |
| 3300022053 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaG (v2) | Environmental | Open in IMG/M |
| 3300022179 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MLB.D.N | Environmental | Open in IMG/M |
| 3300022591 | Freshwater microbial communities from thermokarst lake SAS2a, Kuujjuarapick, Canada - Sample Summer S2 | Environmental | Open in IMG/M |
| 3300022867 | Saline water microbial communities from Ace Lake, Antarctica - #1 | Environmental | Open in IMG/M |
| 3300022927 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041413US metaG | Environmental | Open in IMG/M |
| 3300023235 | Saline water microbial communities from Ace Lake, Antarctica - #50 | Environmental | Open in IMG/M |
| 3300023501 | Saline water microbial communities from Ace Lake, Antarctica - #1159 | Environmental | Open in IMG/M |
| 3300024346 | Whole water sample coassembly | Environmental | Open in IMG/M |
| 3300024496 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Yuk_RepB_8h | Environmental | Open in IMG/M |
| 3300024500 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Cont_RepC_0h | Environmental | Open in IMG/M |
| 3300024505 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Yuk_RepA_8h | Environmental | Open in IMG/M |
| 3300025368 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH24Jun08 (SPAdes) | Environmental | Open in IMG/M |
| 3300025391 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE08Jun09 (SPAdes) | Environmental | Open in IMG/M |
| 3300025398 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE15Jun09 (SPAdes) | Environmental | Open in IMG/M |
| 3300025400 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH27Jul09 (SPAdes) | Environmental | Open in IMG/M |
| 3300025407 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE24Aug09 (SPAdes) | Environmental | Open in IMG/M |
| 3300025416 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH29Jun09 (SPAdes) | Environmental | Open in IMG/M |
| 3300025421 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH27Jul07 (SPAdes) | Environmental | Open in IMG/M |
| 3300025430 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH12Jul09 (SPAdes) | Environmental | Open in IMG/M |
| 3300025437 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH28Sep08 (SPAdes) | Environmental | Open in IMG/M |
| 3300025466 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE25Aug07 (SPAdes) | Environmental | Open in IMG/M |
| 3300025598 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE02Aug07 (SPAdes) | Environmental | Open in IMG/M |
| 3300025645 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 (SPAdes) | Environmental | Open in IMG/M |
| 3300025723 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE03Jun09 (SPAdes) | Environmental | Open in IMG/M |
| 3300025783 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH08Jun09 (SPAdes) | Environmental | Open in IMG/M |
| 3300025896 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300026455 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Atl_RepC_8h | Environmental | Open in IMG/M |
| 3300027508 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Yuk_RepA_8h | Environmental | Open in IMG/M |
| 3300027693 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 1-3cm September2015 (SPAdes) | Environmental | Open in IMG/M |
| 3300027734 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027736 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140205_XF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027804 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MLB.SN (SPAdes) | Environmental | Open in IMG/M |
| 3300027805 | Freshwater and sediment microbial communities from dead zone in Sandusky Bay, Ohio, USA (SPAdes) | Environmental | Open in IMG/M |
| 3300027896 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies -HBP12 HB (SPAdes) | Environmental | Open in IMG/M |
| 3300028108 | Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Yuk_RepB_8d (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031759 | Freshwater microbial communities from Trout Bog Lake, Wisconsin, USA - TBH18003P | Environmental | Open in IMG/M |
| 3300031857 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA125 | Environmental | Open in IMG/M |
| 3300031885 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G09_36 | Environmental | Open in IMG/M |
| 3300031999 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G02_20 | Environmental | Open in IMG/M |
| 3300032093 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA117 | Environmental | Open in IMG/M |
| 3300032116 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA119 | Environmental | Open in IMG/M |
| 3300032275 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C1_bottom | Environmental | Open in IMG/M |
| 3300032561 | Freshwater microbial communities from Trout Bog Lake, Wisconsin, USA - TBH18011 | Environmental | Open in IMG/M |
| 3300032562 | Freshwater microbial communities from Trout Bog Lake, Wisconsin, USA - TBH18017 | Environmental | Open in IMG/M |
| 3300032579 | Freshwater microbial communities from Trout Bog Lake, Wisconsin, USA - TBH18021 | Environmental | Open in IMG/M |
| 3300032753 | Freshwater microbial communities from Trout Bog Lake, Wisconsin, USA - TBH18013 | Environmental | Open in IMG/M |
| 3300034061 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Sep2004-rr0028 | Environmental | Open in IMG/M |
| 3300034063 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Oct2008D10-rr0053 | Environmental | Open in IMG/M |
| 3300034068 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME13Apr2016-rr0031 | Environmental | Open in IMG/M |
| 3300034071 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Oct2008D10-rr0110 | Environmental | Open in IMG/M |
| 3300034082 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME05Jun2015-rr0088 | Environmental | Open in IMG/M |
| 3300034104 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Aug2005-rr0120 | Environmental | Open in IMG/M |
| 3300034105 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME15May2014-rr0127 | Environmental | Open in IMG/M |
| 3300034272 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Jul2017-rr0156 | Environmental | Open in IMG/M |
| 3300034283 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07Aug2003-rr0061 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| Draft_04130543 | 3300000032 | Hydrocarbon Resource Environments | FTHLYNNRSNSTTEKIREIPFGVATLLRPYKPLVM* |
| TB03JUN2009E_0446531 | 3300000176 | Freshwater | VIQQAGLMILTHLYNNRSDTTSTNLKQIPMGAAALLRPYKPLVL* |
| TB18AUG2009E_0005731 | 3300000203 | Freshwater | YQTNANPLAQYPVIQQAGLLLLTHLYNNRSNTFNGKLDEIPFGVAQLLRPYKPLVM* |
| JGIcombinedJ13537_100019549 | 3300001097 | Hypersaline | MTAPVIATYTLAVSPLSTYPVIKQAALLWFTHLYNNRSQSTELNLKQIPLGVDTLLRPYKPLVM* |
| RCM27_10936561 | 3300001836 | Marine Plankton | VANPISAYPVIKQAGLLLFTHLYNNRANATEVKLKDIPFGVTTLLRPYKPLVM* |
| RCM33_10211471 | 3300001838 | Marine Plankton | PVIKQAGLLLFTHLYNNRSNSVEKALQEIPFGFYSLLRPYKTLVM* |
| RCM40_10592163 | 3300001839 | Marine Plankton | VLATYPVIQQAGLLLLTHLYNNRDAAVNPMQHKIPYGIEMLLRPYKPLVM* |
| RCM30_11035881 | 3300001842 | Marine Plankton | QQAGLMLLTHIYNQRSNSFQGTLTEIPFGVGQLLRPYKPLVL* |
| RCM31_103568531 | 3300001851 | Marine Plankton | LYNNRSNTVESSMGLKNIPFGFDTLLRKYKDLVM* |
| JGI24218J26658_100285210 | 3300002092 | Lentic | PYAAYPVIQQAGLMILTHLYNNRSDTTSTNLKQIPMGAAALLRPYKPLVL* |
| metazooDRAFT_13466481 | 3300002212 | Lake | SIIAQYPVIKQAALLLLTHLYNNRSNTVVGNIGLKDIPFGVAQLLRPYKPLVL* |
| MLSBCLC_102224074 | 3300002220 | Hydrocarbon Resource Environments | SPLANYPVIQQAGLLLLTHLYNNRSNSNERIMHEIPFGVAQLLRPYKPLVM* |
| JGI25907J50239_100491210 | 3300003394 | Freshwater Lake | IKQAGLLLLTHLYNQRSNSTEASLKNIPFGVDTLLRPYKELVM* |
| JGI25911J50253_100670104 | 3300003411 | Freshwater Lake | QAYPVIKQAGLLLFTHLYNNRSESVAGGLQKIPYGVDCLLRPYKPLVM* |
| JGI25922J50271_100033701 | 3300003413 | Freshwater Lake | VQQAGLLMLTHLYNNRSNTTETKLNQIPFGIEQLLRPYKSLVM* |
| JGI25921J50272_100431711 | 3300003430 | Freshwater Lake | AQYPIVQQAGLLMLTHLYNNRSNTTETKLNQIPFGIEQLLRPYKSLVM* |
| Ga0007864_10058283 | 3300003806 | Freshwater | YPVIQQAGLLLLTHLYNNRSNTTMTKLNEIPYGVAALLRPYKPLVM* |
| Ga0007879_10175791 | 3300003813 | Freshwater | ANPLASYPVIQQAGLLLLTHLYNNRSDTTTGQLAKLPFGVEQLLRPYKPLVL* |
| Ga0007863_10011939 | 3300003820 | Freshwater | QYPVIQQAGLMLLTHLYNNRSNTTATALKEIPYGVAALLRPYKPLVM* |
| Ga0031655_101197191 | 3300003852 | Freshwater Lake Sediment | ALLLLTHLYNNRSNSFQGALNNIPFGIDQLLRAYKPLVM* |
| Ga0007787_101940853 | 3300004240 | Freshwater Lake | KQAALLLLTHLYNNRAETTLSKLQNIPYGVDALLRPYKPLVM* |
| Ga0066599_1016187852 | 3300004282 | Freshwater | PNIIAQYPVIKQAGLLLFTHLYNNRSDTTATGLQKIPFGVDALLRPYKPLVM* |
| Ga0069718_146327212 | 3300004481 | Sediment | YPVIKQAGLLLLTHLYNNRSNSTDIQLKDIPFGVTTLLRSYKPLVM* |
| Ga0065173_10776072 | 3300004686 | Freshwater | AYPVIQQAGLMILTHLYNNRSNTTSTNLKEIPMGAAALLRPYKPLVL* |
| Ga0065171_10162191 | 3300004692 | Freshwater | SSPYAAYPVIQQAGLMILTHLYNNRSDTTSTNLKQIPFGAAALLRPYKPLVL* |
| Ga0007804_10966203 | 3300004770 | Freshwater | VIQQAGLLLLTHLYNNRSDTTVGQLAKLPFGVDQLLRPYKSLVL* |
| Ga0007804_11860651 | 3300004770 | Freshwater | PVIQQAGLLLLTHLYNNRSDTTTGQLAKLPFGVEQLLRPYKPLVL* |
| Ga0007794_102105712 | 3300004774 | Freshwater | ISAYPVIKQAGLLLLTHLYNNRSNTVDTPIREIPFGVATLLRNYKPLVM* |
| Ga0049080_100807491 | 3300005582 | Freshwater Lentic | LTHLYNNRSNTTDVTLKDIPFGVSTLLRPYKPLVM* |
| Ga0049082_102661092 | 3300005584 | Freshwater Lentic | AANPLQTYPAIKQAGLLLLTHLYIQRSNSTEATLKNIPFGVDTLLRPYKELVM* |
| Ga0075117_11108021 | 3300005914 | Saline Lake | QAGLMLLTHIYNQRSDTTTENLRNIPFGVSTLLRPYKPLVM* |
| Ga0007810_11044982 | 3300006101 | Freshwater | YPVIKQAGLMMLTHLYNNRSDTFNGVMNKIPYGVEQLLRPYKPLVL* |
| Ga0007862_10842661 | 3300006108 | Freshwater | THLYNNRSETTVGRLAELPIGIDALLRPYKPLVM* |
| Ga0007818_10105366 | 3300006117 | Freshwater | TLSVNPLASYPVIQQAGLLLLTHLYNNRSDTTVGQLAKLPFGVDQLLRPYKSLVL* |
| Ga0007873_10229531 | 3300006124 | Freshwater | QAGLLMLTHLYNNRSNSFQGALNDIPYGFDALLRPYKPLVM* |
| Ga0007828_11041413 | 3300006128 | Freshwater | MLTHLYNNRSDTFNGVMNKIPYGVEQLLRPYKPLVL* |
| Ga0075471_105945181 | 3300006641 | Aqueous | LLTHLYNNRSDTTGPIQHKIPFGFEQLLKPYKPLVM* |
| Ga0075467_104636491 | 3300006803 | Aqueous | YVAPANPVAAYQVIKQAGLLLFTHLYNNRSDTTDGNSKPIPFGVATLLRPYKPLVM* |
| Ga0075464_103311081 | 3300006805 | Aqueous | EYVSPANPIAAYQVVKQAGLLLFTHLYNNRSDTTDGNSKPIPFGVATLLRPYKPLVM* |
| Ga0075472_102636031 | 3300006917 | Aqueous | PSPLAAYPVIKQAGLLLLTHLYNNRSNSTEGMLRDIPFGVNALLRPYRPLVM* |
| Ga0075472_106719011 | 3300006917 | Aqueous | IQQAGLLLLTHLYNNRSDTTVDRLKKIPFGVEQILRPYKPLVM* |
| Ga0102828_10528571 | 3300007559 | Estuarine | NPIVVQYTTAANPLQTYPAIKQAGLLLLTHLYNQRSNSTEASLKNIPFGVDTLLRPYKELVM* |
| Ga0102859_11339961 | 3300007708 | Estuarine | IMQYPVIKQAGLLLLTHLYNNRSNTTEVALKSIPFGVDALLRPYKPLIM* |
| Ga0105746_10696604 | 3300007973 | Estuary Water | IKQAGLLLFTHLYNNRSDTTDGNTKPIPFGVATLLRPYKPLVM* |
| Ga0108970_117005763 | 3300008055 | Estuary | PVIKQAGLLLLTHLYNNRSDTTETKLKTIPFGVQALLRPYKPLVM* |
| Ga0114346_11470305 | 3300008113 | Freshwater, Plankton | ANPLSAYPVIKQAGLLLLTHLYNNRSNSTDIQLKDIPFGVTTLLRSYKPLVM* |
| Ga0114350_10664691 | 3300008116 | Freshwater, Plankton | TSPVIVTYTLAASPLGTYPIVKQAGLLWFTHLYNNRSDVTSTDMKRIPMGVDTLLRPYKPLVM* |
| Ga0114364_11653542 | 3300008267 | Freshwater, Plankton | STVANPLAAYPVIKQAGLLLLTHLYNNRANATETKLKDIPFGVTTLLRPYKPLVM* |
| Ga0114880_11005721 | 3300008450 | Freshwater Lake | PVVKQAGLLWFTHLYNNRSEVTSTDMKRIPLGVDTLLRPYKPLIM* |
| Ga0114880_11558563 | 3300008450 | Freshwater Lake | PVVKQAGLLWFTHLYNNRSEVTSTDMKRIPLGVDTLLRPYKPLVM* |
| Ga0102831_11935553 | 3300008996 | Estuarine | QAGLLLLTHLYNNRSDTTEIQLKNIPFGIATLLRPYKPLVM* |
| Ga0102829_10434751 | 3300009026 | Estuarine | NPIVVNYTTAANPLQTYPAIKQAGLLLLTHLYNQRSNSTETSLKNIPFGVDTLLRPYKELVM* |
| Ga0105103_102096234 | 3300009085 | Freshwater Sediment | AGLLLFTHLYNNRSESVEGNLQKIPYGVDCLLRPYKPLVM* |
| Ga0105103_108353142 | 3300009085 | Freshwater Sediment | QQAGLLLLTHLYNNRSNSNERIMHEIPFGVAQLLRPYKPLVM* |
| Ga0114968_101793271 | 3300009155 | Freshwater Lake | THLYNNRSDTTDGNSKPIPFGVATLLRPYKPLVM* |
| Ga0105097_100139481 | 3300009169 | Freshwater Sediment | THLYNNRAETTLTKLQNIPYGVDALLRPYKPLVM* |
| Ga0105097_100387968 | 3300009169 | Freshwater Sediment | TTTANPIASYPVVKQAALLLLTHLYNNRANATETKLKDIPFGVTTLLRLYKPLVM* |
| Ga0114974_102802701 | 3300009183 | Freshwater Lake | AGLLLFTHLYNNRSNTTDTLLKEIPFGVSTLLRPYKPLVM* |
| Ga0114974_104153373 | 3300009183 | Freshwater Lake | VIKQAGLLLLTHLYNNRSDTLDGRLTNIPFGVSQLLRPYKPLVM* |
| Ga0114960_100984125 | 3300010158 | Freshwater Lake | LLLTHLYNNRSNTVVNNLSEIPFGVAQLLRPYKSLVM* |
| Ga0129333_115518322 | 3300010354 | Freshwater To Marine Saline Gradient | YTLAASPFATYPVVKQAGLLWFTHLYNNRSEVTSTDMKRIPLGVDTLLRPYKPLVM* |
| Ga0129333_117388852 | 3300010354 | Freshwater To Marine Saline Gradient | IKQAGLLLLTHLYNNRAETTLSKLQNIPFGVDALLRPYKPLVM* |
| Ga0133913_109683316 | 3300010885 | Freshwater Lake | YTTVSNPLSNYPVIKQAGLLLLTHLYNNRSNTTDGLLREIPFGVATLLRNYKPLVM* |
| Ga0133913_125581061 | 3300010885 | Freshwater Lake | TTAANPIASYPVIKQAGLLLLTHIYNNRSNSTEVKLKEIPFGVATLLRPYKPLVM* |
| Ga0133913_133144091 | 3300010885 | Freshwater Lake | LLLLTHLYNNRSETTLSKLQNIPYGVDALLRPYKLLVM* |
| Ga0137675_10151093 | 3300010966 | Pond Fresh Water | PVIVTYTLSASPLASYPVIKQAGLLWFTHLYNNRSAVGETVGQLAQIPLGVDTLLRPYKPLIM* |
| Ga0137575_100141131 | 3300010970 | Pond Fresh Water | IKQAGLLLLTHLYNNRSDTTMGILHKIPFGVEMLLRPYKPLVL* |
| Ga0139557_10338663 | 3300011010 | Freshwater | QAGLLLFTHLYNNRSNTTDIQLKEIPFGVAALLRPYKPLVM* |
| Ga0153805_10231294 | 3300012013 | Surface Ice | VIKQAGLLLFTHLYNHRSDTTEGNSKPIPFGVATLLRPYKPLVM* |
| Ga0157498_10031501 | 3300012666 | Freshwater, Surface Ice | GYPIIKQAGLLLFTHLYNNRSESVTDSLQKIPYGVDCLLRPYKPLVM* |
| Ga0157498_10726721 | 3300012666 | Freshwater, Surface Ice | YCTAPNPISYYPVVKQAGLLLLTHLYNNRSESTEGVLHQIPFGVSTLLRPYKPLVM* |
| Ga0164292_100153741 | 3300013005 | Freshwater | THLYNQRSNSTEASLKNIPFGVDTLLRPYKELVM* |
| Ga0164295_100150281 | 3300013014 | Freshwater | LPQYPVIKQAGLLLLTHLYNNRSNTTERIMHELPYGVSQLLRPYKPLVM* |
| Ga0164296_13751902 | 3300013093 | Freshwater | QAGLMILTHLYNNRSNTTSTNLKEIPMGAAALLRPYKPLVL* |
| Ga0134314_1010231 | 3300014711 | Surface Water | AGLLLLTHLYNNRANATETKLKDIPFGVTTLLRPYKPLVM* |
| Ga0181365_10671981 | 3300017736 | Freshwater Lake | NPIVVNYTTAANPLQTYPAIKQAGLLLLTHLYNQRSNSTEATLKNIPFGVDTLLRPYKELVM |
| Ga0181344_10494384 | 3300017754 | Freshwater Lake | VQQAGLLMLTHLYNNRSNTTETKLNQIPFGIEQLLRPYKSLVM |
| Ga0181355_11192203 | 3300017785 | Freshwater Lake | MANPIVVNYTTAANPLQTYPAIKQAGLLLLTHLYNQRSNSTEATLKNIPFGVDTLLRPYKELVM |
| Ga0181359_10119269 | 3300019784 | Freshwater Lake | AANPLQTYPVIKQAGLLLLTHLYNNRSNTTEVQLKDIPFGVSTLLRSYKPLVM |
| Ga0211732_15228761 | 3300020141 | Freshwater | PVIKQAGLLLLTHLYNNRSNTTAGIMHDIPFGVAQLLRPYKPLVL |
| Ga0211733_105967211 | 3300020160 | Freshwater | VIKQAGLLLFTHLYNNRSESVAGGLQKIPYGVDCLLRPYKPLVM |
| Ga0211735_109587033 | 3300020162 | Freshwater | VIKQAGLLLFTHLYNNRSESVTDSLQKIPYGVDCLLRPYKPLVM |
| Ga0194115_102451823 | 3300020183 | Freshwater Lake | GLLMVAHLYNQRSDTSERKLNCIPFGVEALLRPYKPLVM |
| Ga0211731_100849301 | 3300020205 | Freshwater | KQAGLMLLTHIYNNRSNTTTGILHDIPFGVATLLRPYKPLVL |
| Ga0208465_10375543 | 3300020570 | Freshwater | KQAGLLLLTHLYNNRSNSTDGMLRDIPFGVTALLRPYKPLVM |
| Ga0214230_1260411 | 3300020697 | Freshwater | ASYPVIQQAGLLLLTHLYNNRSDTTVGQLAKLPFGVDQLLRPYKPLVL |
| Ga0214254_10156814 | 3300020715 | Freshwater | ASPLAQYPVIRQAGLLLLTHLYNNRSNSFQGALNNIPFGVDQLLRAYKPLVM |
| Ga0214248_10158871 | 3300020717 | Freshwater | ALLLLTHLYNNRSNSFQGALNNIPFGIDQLLRAYKPLVM |
| Ga0214178_10022091 | 3300020718 | Freshwater | LLLTHLYNNRSDTTVGQLAKLPFGVDQLLRPYKPLVL |
| Ga0214244_10423431 | 3300020724 | Freshwater | VIQQAGLLLLTHLYNNRSDTTVGQLAKLPFGVDQLLRPYKPLVL |
| Ga0214246_10141351 | 3300020727 | Freshwater | PYASYPVIQQAGLMILTHLYNNRSDTTSTNLKQIPMGAAALLRPYKPLVL |
| Ga0214201_100280910 | 3300020732 | Freshwater | QTNANPLAQYPVIQQAGLLLLTHLYNNRSNTFNGKLDEIPFGVAQLLRPYKPLVM |
| Ga0214201_10561581 | 3300020732 | Freshwater | AANPLASYPVIQQAGLLLLTHLYNNRSDTTVGQLAKLPFGVDQLLRPYKPLVL |
| Ga0214219_10194071 | 3300020735 | Freshwater | QYPVIKQAGLLLLTHLYNNRSNTGASKLSDIPFGVDTLLRPYKPLVM |
| Ga0214211_10029226 | 3300021125 | Freshwater | ANPLASYPVIQQAGLLLLTHLYNNRSDTTVGQLAKLPFGVDQLLRPYKPLVL |
| Ga0214193_10033641 | 3300021127 | Freshwater | RLASYPVIQQAGLLLLTHLYNNRSDTTVGQLAKLPFGVDQLLRPYKPLVL |
| Ga0214164_11040382 | 3300021138 | Freshwater | VIQQAGLLLLTHLYNNRSNTTMTKLNEIPYGVAALLRPYKPLVM |
| Ga0214192_10492961 | 3300021142 | Freshwater | LTHLYNNRSDTTTGQLAKLPFGVEQLLRPYKPLVL |
| Ga0213922_10374824 | 3300021956 | Freshwater | KANPLSAYPVIKQAGLLLLTHLYNNRSNTTAGIMHEIPFGVAQLLRPYKPLVL |
| Ga0213922_10841413 | 3300021956 | Freshwater | EYTVAASPLAAYPVIKQAGLLLLTHLYNNRSNTTEPIMHEIPFGVAQLLRNYKPLVM |
| Ga0213922_11261831 | 3300021956 | Freshwater | LQAYPVIKQAGLLLFTHLYNNRAETTLSKLQTIPYGVDALLRPYKPLVM |
| Ga0222713_103833951 | 3300021962 | Estuarine Water | FTQAYPVIKQAGLLLFTHLYNNRSESVAGGLQKIPYGVDCLLRPYKQLVM |
| Ga0212030_10134564 | 3300022053 | Aqueous | ASALADYPVIKQAGLLLYTHLYNNRSNTTELKLTDLPFGVNTLLRPYKPLVM |
| Ga0181353_10191851 | 3300022179 | Freshwater Lake | LTHLYNNRAETTLSKLQNIPYGVDALLRPYKPLVM |
| Ga0236341_10486694 | 3300022591 | Freshwater | AALLLLTHLYNNRSNSFQGALNNIPFGIDQLLRAYKPLVM |
| Ga0222629_10111674 | 3300022867 | Saline Water | IKQAGLMLLTHIYNQRSDTTTENLRNIPFGVSTLLRPYKPLVM |
| Ga0255769_102122911 | 3300022927 | Salt Marsh | ANPLQTYPAIKQAGLLLLTHLYNQRSNSTEASLKNIPFGVDTLLRPYKELVM |
| Ga0222634_10283403 | 3300023235 | Saline Water | LAQYPVIKQAGLMLLTHIYNQRSDTTTENLRNIPFGVSTLLRPYKPLVM |
| Ga0222686_10140664 | 3300023501 | Saline Water | PVIKQAGLMLLTHIYNQRSDTTTENLRNIPFGVSTLLRPYKPLVM |
| Ga0244775_106161461 | 3300024346 | Estuarine | IKQAGLLLLTHIYNNRSNTTETNLKSIPFGVDQLLRSYKPLVM |
| Ga0244775_109577753 | 3300024346 | Estuarine | PVIKQAGLLLLTHLYNNRSDTLDGRLTNIPFGVSQLLRPYKPLVM |
| Ga0244775_115346001 | 3300024346 | Estuarine | VIKQAGLLLFTHLYNNRSESVADGLQKIPYGVDCLLRPYKPLVM |
| Ga0255151_10621141 | 3300024496 | Freshwater | NPMAQYPVIKQAGLLLLTHLYNNRSETTVKKQVSIPWGIDMLLRPYKPLVL |
| Ga0255143_10871641 | 3300024500 | Freshwater | KQAGLMLLTHIYNNRSNTTEAKLHEVPFGVATLLRPYKPLVM |
| Ga0255150_10425383 | 3300024505 | Freshwater | NLGANPMAQYPVIKQAGLLLLTHLYNNRSETTVKKQVSIPWGIDMLLRPYKPLVL |
| Ga0208620_10086981 | 3300025368 | Freshwater | IKQAGLLLLTHLYNNRSNTFNGKLADIPYGVDQLLRPYKPLVM |
| Ga0208740_10020631 | 3300025391 | Freshwater | PLAQYPVIQQAGLLLLTHLYNNRSNTFNGKLDEIPFGVAQLLRPYKPLVM |
| Ga0208251_10673412 | 3300025398 | Freshwater | YPVIKQAGLMMLTHLYNNRSDTFNGVMNKIPYGVEQLLRPYKPLVL |
| Ga0208387_10496033 | 3300025400 | Freshwater | GLMLLTHLYNNRSNTTATSLKEIPYGVAALLRPYKPLVM |
| Ga0208378_10397621 | 3300025407 | Freshwater | ANPLASYPVIQQAGLLLLTHLYNNRSDTTTGQLAKLPFGVEQLLRPYKPLVL |
| Ga0208877_10176071 | 3300025416 | Freshwater | GLLLLTHLYNNRSDTTVGQLAKLPFGVDQLLRPYKSLVL |
| Ga0208877_10670431 | 3300025416 | Freshwater | QYPVIKQAGLLLLTHLYNNRSETTVGRLAELPIGIDALLRPYKPLVM |
| Ga0207958_10128894 | 3300025421 | Freshwater | IVCTYTTNSSPLAQYPVIQQAGLLLLTHLYNNRSNTFNGKLDEIPFGVAQLLRPYKPLVM |
| Ga0208622_10394491 | 3300025430 | Freshwater | AGLLLLTHLYNNRSDTTVGQLAKLPFGVDQLLRPYKPLVL |
| Ga0208742_10841851 | 3300025437 | Freshwater | AANPYAQYPVIQQAGLMLLTHLYNNRSNTTATALKEIPYGVAALLRPYKSLVM |
| Ga0208497_10027071 | 3300025466 | Freshwater | AGLLLLTHLYNNRSNTFNGKLDEIPFGVAQLLRPYKPLVM |
| Ga0208497_10572561 | 3300025466 | Freshwater | YPVIQQAGLLLLTHLYNNRSDTTVGQLAKLPFGVDQLLRPYKSLVL |
| Ga0208379_10366241 | 3300025598 | Freshwater | ASYPVIQQAGLMILTHLYNNRSDTTSTNLKQIPMGAAALLRPYKPLVL |
| Ga0208643_10143878 | 3300025645 | Aqueous | IEYTLAESDLAQYPVIKQAGLLLFTHLYNNRSETTNGGLQTIPYGVDALLRPYKPLVM |
| Ga0208741_100133826 | 3300025723 | Freshwater | ANPLAAYPVIQQAGLLLLTHLYNNRSNTTMTKLNEIPYGVAALLRPYKPLVM |
| Ga0208741_100320351 | 3300025723 | Freshwater | YPVIQQAGLLLLTHLYNNRSDTTVGQLAKLPFGVDQLLRPYKPLVL |
| Ga0208258_10080175 | 3300025783 | Freshwater | AQYPVIQQAGLLLLTHLYNNRSNTFNGKLDEIPFGVAQLLRPYKPLVM |
| Ga0208916_103552811 | 3300025896 | Aqueous | NILATYPVIKQAGLLILTHLYNNRSDATETKLKTIPYGAQVLLRPYKSLVM |
| Ga0208916_103941401 | 3300025896 | Aqueous | EYVSPANPIAAYQVVKQAGLLLFTHLYNNRSDTTDGNSKPIPFGVATLLRPYKPLVM |
| Ga0255155_10019271 | 3300026455 | Freshwater | ALLLFTHLYNNRSNTTEMNLKTIPMGFDVLLRPYKPLVM |
| Ga0255072_10818391 | 3300027508 | Freshwater | PVIKQAGLLLFTHLYNNRSESVTDGLQKIPYGVDCLLRPYKPLVM |
| Ga0209704_11129213 | 3300027693 | Freshwater Sediment | KQAGLLLLTHLYNNRANATETRLKDIPFGVTTLLRNYKPLVM |
| Ga0209087_10045921 | 3300027734 | Freshwater Lake | ASYPVIQQAGLLLFTHLYNNRSNTTEVAQKDIPFGFSTLLRAYKPLVM |
| Ga0209190_13494421 | 3300027736 | Freshwater Lake | IQVLYTVNANPIGQYPVIKQAGLLLLTHLYNQRSNTTEVRLNTIPFGVDTLLRPYKPLVM |
| Ga0209358_102166111 | 3300027804 | Freshwater Lake | AALLLLTHLYNNRAETTLSKLQNIPYGVDALLRPYKPLVM |
| Ga0209229_100873554 | 3300027805 | Freshwater And Sediment | TVSNPLAAYPVIKQAGLLLLTHLYNNRSNSTEVQLKDIPFGVTTLLRSYKPLVM |
| Ga0209777_102009521 | 3300027896 | Freshwater Lake Sediment | PIAQYPVIKQAALLLLTHLYNNRSNSFQGALNNIPFGIDQLLRAYKPLVM |
| Ga0209777_108102073 | 3300027896 | Freshwater Lake Sediment | LYTANASPYAAYPVIKLAGLMLLTHLYNNRSNTFQGVLKEIPYGVAALLRPYKPLVM |
| Ga0256305_11424771 | 3300028108 | Freshwater | PVIKQAGLLLLTHLYNNRSNTTEVALKSIPFGVDALLRSYKPLVM |
| Ga0316219_12337093 | 3300031759 | Freshwater | QAGLLLLTHLYNNRSDTTVGQLAKLPFGVDQLLRPYKPLVL |
| Ga0315909_109168062 | 3300031857 | Freshwater | TVEASPLAAYPVIKQAGLLLLTHLYNNRSNSTEGMLRDIPFGVNALLRPYKPLVM |
| Ga0315285_101913231 | 3300031885 | Sediment | IKQAGLLLFTHLYNNRSESVTDGLQKIPYGVDCLLRPYKPLVM |
| Ga0315274_106919231 | 3300031999 | Sediment | FTHLYNNRSESVTDGLQKIPYGVDCLLRPYKPLVM |
| Ga0315902_101921896 | 3300032093 | Freshwater | NFIAQYPVIQQAGLLLLTHLYNNRSETTAGKLHDIPFGVKALLRPYKTLVM |
| Ga0315903_100024451 | 3300032116 | Freshwater | ANPLASYKVIKQAGLLLMTHLYNNRANATETKLKDIPFGVTTLLRSYKPLVM |
| Ga0315270_111164521 | 3300032275 | Sediment | QAALLLLTHLYNNRSNTTNILQKDIPFGVSTLLRPYKPLVM |
| Ga0316222_10922401 | 3300032561 | Freshwater | SNSSPYASYPVIQQAGLMILTHLYNNRSDTTSMNLKQIPMGAAALLRPYKPLVL |
| Ga0316222_11165411 | 3300032561 | Freshwater | RQAGLLLLTHLYNNRSNSFQGALNNIPFGVDQLLRLYKPLVM |
| Ga0316222_11167871 | 3300032561 | Freshwater | ASPYAQYPVIQQAGLMMLTHLYNNRSDTFNGVMNKIPYGVEQLLRPYKPLVL |
| Ga0316226_13420353 | 3300032562 | Freshwater | VIRQAGLLLLTHLYNNRSNSFQGALNNIPFGVDQLLRAYKPLVM |
| Ga0316228_12117881 | 3300032579 | Freshwater | LTHLYNNRSDTTNMRMLDIPFGVATLLRPYKSLVM |
| Ga0316224_12163441 | 3300032753 | Freshwater | AQYPVIRQAGLLLLTHLYNNRSNSFQGALNNIPFGVDQLLRAYKPLVM |
| Ga0334987_0335341_1_141 | 3300034061 | Freshwater | YPVIKQAGLLLLTHLYNNRANATETKLKDIPFGVTTLLRPYKPLIM |
| Ga0335000_0389444_1_126 | 3300034063 | Freshwater | QAGLLLLTHLYNNRSETTAGALQKIPFGVDVLLRQYKPLVM |
| Ga0334990_0003134_3_191 | 3300034068 | Freshwater | NPIVVQYTTAPNPLQTYPAIKQAGLLLLTHLYNQRSNSTEASLKNIPFGVDTLLRPYKELVM |
| Ga0335028_0240932_988_1098 | 3300034071 | Freshwater | LLTHLYNNRSETTAGALQKIPFGVDVLLRQYKPLVM |
| Ga0335020_0137018_2_145 | 3300034082 | Freshwater | AYPVIKQAGLLLLTHLYNNRSESTEGVLHQIPFGVSTLLRPYKPLVM |
| Ga0335031_0608854_1_138 | 3300034104 | Freshwater | PVIKQAGLLLFTHLYNNRSNTVDTPLREIPYGVSALLRPYKPLVI |
| Ga0335035_0487540_3_125 | 3300034105 | Freshwater | AGLLLLTHLYNQRSNSTEASLKNIPFGVDTLLRPYKELVM |
| Ga0335049_0713589_446_604 | 3300034272 | Freshwater | ANFTQAYPVIKQAGLLLFTHLYNNRSESVTDGLQKIPYGVDCLLRPYKPLVM |
| Ga0335007_0049551_3127_3243 | 3300034283 | Freshwater | LLLFTHLYNNRSESVAGGLQKIPYGVDCLLRPYKPLVM |
| ⦗Top⦘ |