Scaffold Ga0214490_1055115

Overview

Basic Information

• Taxon OID: 3300032502
• Scaffold ID: Ga0214490_1055115
• Source Dataset Name: Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_MAIN_12JUL2016_LR1 (Metagenome Metatranscriptome)
• Source Dataset Category: Metatranscriptome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 904
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (66.67%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Switchgrass Phyllosphere → Phyllosphere Microbial Comminities From Bioenergy Crops Switchgrass And Miscanthus From Michigan, Usa

Source Dataset Sampling Location

• Location Name: USA: Michigan
• Coordinates
  • Lat. (^o): 42.39
  • Long. (^o): -85.37

Associated Families

Family	Category	Number of Sequences	3D Structure?
F073003	Metagenome / Metatranscriptome	120	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0214490_10551151	F073003	GAG	MKRMASPWVAGVKIAGRKLKMIRDKSRRVEKLLNYSSSRGSGGQGRRKEKQRI