NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F073003

Metagenome / Metatranscriptome Family F073003

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F073003
Family Type Metagenome / Metatranscriptome
Number of Sequences 120
Average Sequence Length 49 residues
Representative Sequence MASPWVAGVKIAGRKLKMIRDKSRRVEKLLKDSSSMGSGGQGRRKEKQRI
Number of Associated Samples 78
Number of Associated Scaffolds 120

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Eukaryota
% of genes with valid RBS motifs 90.68 %
% of genes near scaffold ends (potentially truncated) 50.00 %
% of genes from short scaffolds (< 2000 bps) 96.67 %
Associated GOLD sequencing projects 78
AlphaFold2 3D model prediction Yes
3D model pTM-score0.44

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Eukaryota (71.667 % of family members)
NCBI Taxonomy ID 2759
Taxonomy All Organisms → cellular organisms → Eukaryota

Most Common Ecosystem
GOLD Ecosystem Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Switchgrass Phyllosphere
(66.667 % of family members)
Environment Ontology (ENVO) Unclassified
(91.667 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant surface
(86.667 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 44.87%    β-sheet: 0.00%    Coil/Unstructured: 55.13%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.44
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 120 Family Scaffolds
PF03732Retrotrans_gag 23.33



 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms71.67 %
UnclassifiedrootN/A28.33 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300005467|Ga0070706_101896999Not Available541Open in IMG/M
3300009092|Ga0105250_10072271All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum1394Open in IMG/M
3300009177|Ga0105248_11728817All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae709Open in IMG/M
3300009976|Ga0105128_115369All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae568Open in IMG/M
3300009980|Ga0105135_103909All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae → Oryzinae → Oryza → Oryza sativa921Open in IMG/M
3300009981|Ga0105133_106092All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum807Open in IMG/M
3300009981|Ga0105133_109796Not Available713Open in IMG/M
3300009981|Ga0105133_123344All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae559Open in IMG/M
3300009981|Ga0105133_132253All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae502Open in IMG/M
3300009989|Ga0105131_113241All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae741Open in IMG/M
3300009989|Ga0105131_137110All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae → Oryzinae → Oryza → Oryza sativa536Open in IMG/M
3300009990|Ga0105132_118925All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae664Open in IMG/M
3300009992|Ga0105120_1048634All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae534Open in IMG/M
3300009995|Ga0105139_1032368All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae850Open in IMG/M
3300009995|Ga0105139_1105766All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae543Open in IMG/M
3300009995|Ga0105139_1106731Not Available540Open in IMG/M
3300010397|Ga0134124_11390488All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum727Open in IMG/M
3300010399|Ga0134127_11493698Not Available748Open in IMG/M
3300010401|Ga0134121_13294431Not Available500Open in IMG/M
3300013306|Ga0163162_13381198Not Available510Open in IMG/M
3300014968|Ga0157379_10798102All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae891Open in IMG/M
3300014968|Ga0157379_12655137Not Available502Open in IMG/M
3300015270|Ga0182183_1022915Not Available777Open in IMG/M
3300015273|Ga0182102_1007616All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae803Open in IMG/M
3300015284|Ga0182101_1023739All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum802Open in IMG/M
3300015284|Ga0182101_1058841All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae → Oryzinae → Oryza → Oryza sativa605Open in IMG/M
3300015293|Ga0182103_1041763All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae675Open in IMG/M
3300015297|Ga0182104_1063377All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum633Open in IMG/M
3300015297|Ga0182104_1073990All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae601Open in IMG/M
3300015301|Ga0182184_1091232Not Available521Open in IMG/M
3300015312|Ga0182168_1049636All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae → Oryzinae → Oryza → Oryza sativa735Open in IMG/M
3300015312|Ga0182168_1065330Not Available667Open in IMG/M
3300015313|Ga0182164_1073104All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae641Open in IMG/M
3300015313|Ga0182164_1119963Not Available531Open in IMG/M
3300015315|Ga0182120_1046394All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae758Open in IMG/M
3300015316|Ga0182121_1027177All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae940Open in IMG/M
3300015316|Ga0182121_1055421Not Available737Open in IMG/M
3300015316|Ga0182121_1106838All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae573Open in IMG/M
3300015317|Ga0182136_1023967All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum938Open in IMG/M
3300015318|Ga0182181_1064575All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae616Open in IMG/M
3300015319|Ga0182130_1080481All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae614Open in IMG/M
3300015319|Ga0182130_1114954Not Available538Open in IMG/M
3300015320|Ga0182165_1126813All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae535Open in IMG/M
3300015324|Ga0182134_1034835All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae → Oryzinae → Oryza → Oryza sativa852Open in IMG/M
3300015324|Ga0182134_1043603Not Available792Open in IMG/M
3300015324|Ga0182134_1048342All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae764Open in IMG/M
3300015325|Ga0182148_1041686All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae → Oryzinae → Oryza → Oryza sativa790Open in IMG/M
3300015326|Ga0182166_1029344All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae880Open in IMG/M
3300015328|Ga0182153_1031169All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum889Open in IMG/M
3300015328|Ga0182153_1084172All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae635Open in IMG/M
3300015328|Ga0182153_1113165Not Available567Open in IMG/M
3300015328|Ga0182153_1146749All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum511Open in IMG/M
3300015329|Ga0182135_1041867Not Available818Open in IMG/M
3300015329|Ga0182135_1099140All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae601Open in IMG/M
3300015329|Ga0182135_1124528Not Available550Open in IMG/M
3300015333|Ga0182147_1169303All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae502Open in IMG/M
3300015334|Ga0182132_1101110All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae → Oryzinae → Oryza → Oryza sativa625Open in IMG/M
3300015334|Ga0182132_1146015All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae536Open in IMG/M
3300015336|Ga0182150_1035192All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum896Open in IMG/M
3300015336|Ga0182150_1065263All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae725Open in IMG/M
3300015337|Ga0182151_1108413All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae599Open in IMG/M
3300015337|Ga0182151_1128812All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae559Open in IMG/M
3300015338|Ga0182137_1084581Not Available692Open in IMG/M
3300015338|Ga0182137_1092676All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae667Open in IMG/M
3300015338|Ga0182137_1094928All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Panicum → Panicum hallii661Open in IMG/M
3300015348|Ga0182115_1084460All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum983Open in IMG/M
3300015349|Ga0182185_1210073All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae589Open in IMG/M
3300015350|Ga0182163_1258147All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae546Open in IMG/M
3300015352|Ga0182169_1065536All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae1121Open in IMG/M
3300015352|Ga0182169_1182056All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae687Open in IMG/M
3300015352|Ga0182169_1207753All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae639Open in IMG/M
3300015352|Ga0182169_1314263Not Available502Open in IMG/M
3300015353|Ga0182179_1089973Not Available905Open in IMG/M
3300015353|Ga0182179_1095501All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum883Open in IMG/M
3300015354|Ga0182167_1259365All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae625Open in IMG/M
3300015354|Ga0182167_1342195Not Available524Open in IMG/M
3300015354|Ga0182167_1354640Not Available512Open in IMG/M
3300017414|Ga0182195_1031809All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae1030Open in IMG/M
3300017421|Ga0182213_1090075All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae848Open in IMG/M
3300017421|Ga0182213_1178779All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum601Open in IMG/M
3300017422|Ga0182201_1086588All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae → Oryzinae → Oryza → Oryza sativa602Open in IMG/M
3300017432|Ga0182196_1027212All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae906Open in IMG/M
3300017432|Ga0182196_1148046Not Available512Open in IMG/M
3300017439|Ga0182200_1101955All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae596Open in IMG/M
3300017440|Ga0182214_1078116Not Available688Open in IMG/M
3300017445|Ga0182198_1190886All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae515Open in IMG/M
3300017447|Ga0182215_1108067All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae623Open in IMG/M
3300017447|Ga0182215_1152246Not Available534Open in IMG/M
3300017691|Ga0182212_1166736Not Available504Open in IMG/M
3300017692|Ga0182210_1088711Not Available659Open in IMG/M
3300017693|Ga0182216_1135714All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum615Open in IMG/M
3300017694|Ga0182211_1158498All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae539Open in IMG/M
3300017694|Ga0182211_1165918All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum527Open in IMG/M
3300022465|Ga0213505_116773Not Available594Open in IMG/M
3300025922|Ga0207646_10865303All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum803Open in IMG/M
3300028050|Ga0268328_1045434All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae596Open in IMG/M
3300028051|Ga0268344_1015306All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae595Open in IMG/M
3300028052|Ga0268300_1004914All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae773Open in IMG/M
3300028053|Ga0268346_1005871All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae920Open in IMG/M
3300028053|Ga0268346_1006240All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae906Open in IMG/M
3300028053|Ga0268346_1010055Not Available794Open in IMG/M
3300028055|Ga0268338_1006752Not Available881Open in IMG/M
3300028056|Ga0268330_1056323All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae → Oryzinae → Oryza → Oryza sativa523Open in IMG/M
3300028058|Ga0268332_1031773All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae699Open in IMG/M
3300028058|Ga0268332_1044065Not Available626Open in IMG/M
3300028142|Ga0268347_1024771All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum561Open in IMG/M
3300028144|Ga0268345_1023119All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae544Open in IMG/M
3300028152|Ga0268336_1003984All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae908Open in IMG/M
3300028154|Ga0268341_1002995All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae1021Open in IMG/M
3300028253|Ga0268316_1003331All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae900Open in IMG/M
3300028469|Ga0268337_1019069All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae → Oryzinae → Oryza → Oryza sativa510Open in IMG/M
3300028526|Ga0268339_1010955All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae609Open in IMG/M
3300032465|Ga0214493_1065807All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum861Open in IMG/M
3300032502|Ga0214490_1055115All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae904Open in IMG/M
3300032502|Ga0214490_1122324Not Available592Open in IMG/M
3300032592|Ga0214504_1001171All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum3192Open in IMG/M
3300032844|Ga0314743_1146935All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum520Open in IMG/M
3300033535|Ga0314759_1000816All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum4456Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Switchgrass PhyllosphereHost-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Switchgrass Phyllosphere66.67%
PhyllosphereHost-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Phyllosphere14.17%
Switchgrass AssociatedHost-Associated → Plants → Unclassified → Unclassified → Unclassified → Switchgrass Associated10.83%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil2.50%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere1.67%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere1.67%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere1.67%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.83%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300005467Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaGEnvironmentalOpen in IMG/M
3300009092Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaGHost-AssociatedOpen in IMG/M
3300009177Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaGHost-AssociatedOpen in IMG/M
3300009976Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_186 metaGHost-AssociatedOpen in IMG/M
3300009980Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_219 metaGHost-AssociatedOpen in IMG/M
3300009981Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_208 metaGHost-AssociatedOpen in IMG/M
3300009989Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_197 metaGHost-AssociatedOpen in IMG/M
3300009990Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_206 metaGHost-AssociatedOpen in IMG/M
3300009992Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_108 metaGHost-AssociatedOpen in IMG/M
3300009995Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_227 metaGHost-AssociatedOpen in IMG/M
3300010397Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4EnvironmentalOpen in IMG/M
3300010399Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3EnvironmentalOpen in IMG/M
3300010401Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1EnvironmentalOpen in IMG/M
3300013306Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaGHost-AssociatedOpen in IMG/M
3300014968Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaGHost-AssociatedOpen in IMG/M
3300015270Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_22AUG2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015273Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_09MAY2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015284Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_09MAY2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015293Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_09MAY2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015297Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_09MAY2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015301Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_22AUG2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015312Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_01AUG2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015313Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_01AUG2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015315Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_31MAY2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015316Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_31MAY2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015317Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_20JUN2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015318Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_22AUG2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015319Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_20JUN2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015320Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_01AUG2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015324Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_20JUN2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015325Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_12JUL2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015326Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_01AUG2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015328Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_12JUL2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015329Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_20JUN2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015333Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_12JUL2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015334Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_20JUN2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015336Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_12JUL2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015337Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_12JUL2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015338Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_20JUN2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015348Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_31MAY2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015349Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_22AUG2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015350Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_01AUG2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015352Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_01AUG2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015353Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_22AUG2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015354Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_01AUG2016_LD1 MGHost-AssociatedOpen in IMG/M
3300017414Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_12SEP2016_LD1 MGHost-AssociatedOpen in IMG/M
3300017421Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_03OCT2016_LD1 MGHost-AssociatedOpen in IMG/M
3300017422Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_12SEP2016_LD1 MGHost-AssociatedOpen in IMG/M
3300017432Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_12SEP2016_LD1 MGHost-AssociatedOpen in IMG/M
3300017439Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_12SEP2016_LD1 MGHost-AssociatedOpen in IMG/M
3300017440Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_03OCT2016_LD1 MGHost-AssociatedOpen in IMG/M
3300017445Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_12SEP2016_LD1 MGHost-AssociatedOpen in IMG/M
3300017447Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_03OCT2016_LD1 MGHost-AssociatedOpen in IMG/M
3300017691Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_03OCT2016_LD1 MGHost-AssociatedOpen in IMG/M
3300017692Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_03OCT2016_LD1 MGHost-AssociatedOpen in IMG/M
3300017693Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_03OCT2016_LD1 MGHost-AssociatedOpen in IMG/M
3300017694Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_03OCT2016_LD1 MGHost-AssociatedOpen in IMG/M
3300022465Metatranscriptome of phyllosphere microbial comminities from switchgrass, Michigan, USA - G5R1_MAIN_12JUL2016_LR1 MT pilot (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300025922Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300028050Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_NF_17JUL2017_LD1Host-AssociatedOpen in IMG/M
3300028051Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_NF_28AUG2017_LD1Host-AssociatedOpen in IMG/M
3300028052Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_MAIN_15MAY2017_LD1Host-AssociatedOpen in IMG/M
3300028053Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_NF_28AUG2017_LD1Host-AssociatedOpen in IMG/M
3300028055Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_NF_07AUG2017_LD1Host-AssociatedOpen in IMG/M
3300028056Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_NF_17JUL2017_LD1Host-AssociatedOpen in IMG/M
3300028058Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_MAIN_07AUG2017_LD1Host-AssociatedOpen in IMG/M
3300028142Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_NF_28AUG2017_LD1Host-AssociatedOpen in IMG/M
3300028144Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_NF_28AUG2017_LD1Host-AssociatedOpen in IMG/M
3300028152Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_NF_07AUG2017_LD1Host-AssociatedOpen in IMG/M
3300028154Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_MAIN_28AUG2017_LD1Host-AssociatedOpen in IMG/M
3300028253Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_MAIN_26JUN2017_LD1Host-AssociatedOpen in IMG/M
3300028469Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_NF_07AUG2017_LD1Host-AssociatedOpen in IMG/M
3300028526Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_NF_07AUG2017_LD1Host-AssociatedOpen in IMG/M
3300032465Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_MAIN_12JUL2016_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032502Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_MAIN_12JUL2016_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032592Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_NF_12SEP2016_LR2 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032844Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_17JUL2017_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300033535Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_28AUG2017_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
Ga0070706_10189699913300005467Corn, Switchgrass And Miscanthus RhizosphereRKLKMIRDKSRGVEKLLKDSFSMDSGGQGRRKEKKKIGG*
Ga0105250_1007227123300009092Switchgrass RhizosphereMASPWVAGVKIAGRKLKMIRNEFRRIEKLFKDSSSMGIGGQGRRKEKKSKGYEDN*
Ga0105248_1172881713300009177Switchgrass RhizosphereMASPWVAGVKIAERKLKMIRDKSHRVEKLLKDSFSIDSGGQGRRK*
Ga0105128_11536913300009976Switchgrass AssociatedMASPWVAEVKIAGRKLKMIWDKSRRVEKLFKDSFSLDSGGQGRRKEKQRIRG*
Ga0105135_10390933300009980Switchgrass AssociatedMASPWVAGVKIAERKLKMIRDKSRRVEKLLKDSSSMGSGGQGRRKEKQRV*
Ga0105133_10609223300009981Switchgrass AssociatedMASPWVAGMKIVERKLKMMRDKSHRVEKLLKDTSSMGSGGQGRRKEKQRIQGRLGSKKDT
Ga0105133_10979613300009981Switchgrass AssociatedMASPWVAGVKIAERKLKMIRNKFHRIEKLFKDSFSLDSGYQGRRKEKQRYEDD*
Ga0105133_12334423300009981Switchgrass AssociatedMASPWVVGVKIAGRKLKMIRDKSRRVEKLLKDSSSMGSGGQGRRKEKQRI*
Ga0105133_13225313300009981Switchgrass AssociatedMMSSPWVAGVKIAERKLKMIRNKFCRIEKLFKDSSSMGSGGQGRRKEKQRIRGSLGSKKD
Ga0105131_11324123300009989Switchgrass AssociatedMASPWVAGVKIAGRKLKMIRDKSRRIEKLLKDSSSMGSGGQGRREEKQRIRG*
Ga0105131_13711013300009989Switchgrass AssociatedMASPWVAGVKIAERKLKMMWDKSRRVEKLLKDSFS
Ga0105132_11892513300009990Switchgrass AssociatedMASPWVAGVKIAGRKLKMIRDKSRWVEKLLKDSSSMG
Ga0105120_104863423300009992Switchgrass AssociatedMASPWVAGVQIAGRKLKMIRYKSCRVEKLLKDSSSRD
Ga0105139_103236813300009995Switchgrass AssociatedMASPWVAGVKIAERKLKMIRDKSHGVEKLLKDISSMGSRGQGRRKEKQRIQG*
Ga0105139_110576623300009995Switchgrass AssociatedMASPWVVGVKIAGRKLKMIRDKSRGVENLLKDSSSMGSGGQGR
Ga0105139_110673113300009995Switchgrass AssociatedMASPWVAGVKIAETKLKMIQNKFCRIEKLFKDIFSLDSGGQGRRKEKQRVRG*
Ga0134124_1139048823300010397Terrestrial SoilMASPWVAGVKIAGRKLKMIQDKSRRVEKLLKDNFSMDNGGQGRIKEKQRI*
Ga0134127_1149369813300010399Terrestrial SoilMVFPWVAGVKIAGTKLKMIRDKSRGVEKLLKDSFSMDSGGQGRRKEKKKI*
Ga0134121_1329443113300010401Terrestrial SoilMYCCCERNKPWVEGVKIAERKLKMICNKFHRIEKLFKDSFSLDSGGQGRRKEKQRIRGR
Ga0163162_1338119823300013306Switchgrass RhizosphereMASPWVAGVKIAGRKLKMIRDKSCRVEKLLKNISSMGSGGQGRRKEKQRIRG*
Ga0157379_1079810213300014968Switchgrass RhizosphereMASPWVAGVKIVGRKLKMIRNKFCRIEKLFKDSFSLDSGGQGRRKEKKSKGYEDD*
Ga0157379_1265513713300014968Switchgrass RhizosphereRPLRQRGCERMASPWVAGVKIAERKLKMIRDKSHGIEKLLKDSSSMGSGGQGRRKEKQRYEDD*
Ga0182183_102291523300015270Switchgrass PhyllosphereMASPWVPRVKIVGRKLKMIWDKSRGVEKLLKDSFSMDSGGQGRSKEKKKIRG*
Ga0182102_100761613300015273Switchgrass PhyllosphereMASPWVAGVKIAGRKLKMIRDKSRGVQKLLKDSFSMDSGGQGISKEKKKIRG*
Ga0182101_102373913300015284Switchgrass PhyllosphereMASPWVARVKIAGRKLKMIQDKSRMVEELLKDSSSMGSGGQ
Ga0182101_105884123300015284Switchgrass PhyllosphereMASPWVAGVKIAERKLKMMWDKSRRVEKLLKDSFPIDSGGQCRRKRKAKDMRTTR*
Ga0182103_104176313300015293Switchgrass PhyllosphereMASPWVAGVKIAGRKLKMIRDKSRRVEKLLKDRSSMGSG
Ga0182104_106337713300015297Switchgrass PhyllosphereMASPWIAGVKIAERKLKMIWDKSRRVEKLLKDNFSMDSGGQGRRKEKKKIRGRLGTKKDT
Ga0182104_107399013300015297Switchgrass PhyllosphereMASPWVVGVKIARRKLKMIQDKSHRVEKLLKDSFSIDSGGQGRRK*
Ga0182184_109123213300015301Switchgrass PhyllosphereMACPWIAGVKIAERKLKMIRDKSRRVEKLLKDSSSMGSGGQGR
Ga0182168_104963623300015312Switchgrass PhyllosphereMASSWVAGVKIAGRKLKMIWDKSRGVEKLLKDSFSMDSGGQGRRKEKKKIRG*
Ga0182168_106533023300015312Switchgrass PhyllosphereMASPWVARVKIAGRKLKMIQDKSRMVEELLKDSSSMGSGGQGRRKEKQSI*
Ga0182164_107310423300015313Switchgrass PhyllosphereMASPWVAGVKIAERKLKMMWDKSRRVEKLLKDSFSMDSGGQGRRK*
Ga0182164_111996313300015313Switchgrass PhyllosphereRKLKMIRDKSHGVEKLLKDISSMGSRGQGRRKEKQRIQG*
Ga0182120_104639413300015315Switchgrass PhyllosphereMASSWVAGVKIAERKLKIIRDKSRRVEKLLKDSSYMGSGGQGRRKEKQRI*
Ga0182121_102717713300015316Switchgrass PhyllosphereMASPWVAGVKIAERKLKMIRDKSPRVEKLLKDSFSRDSGGQVRRKEK*
Ga0182121_105542113300015316Switchgrass PhyllosphereMASPWVAGVKIEGRKLKMIWDKSRRVERLLKDSSPMGSRGQGRRKEKQEDD*
Ga0182121_106494213300015316Switchgrass PhyllosphereMDTPWVAGVKIAERKLKMIRDKSRRVEKLLKDSSSIGSGGQGRRKAKDTRTTRFEERYRNRSPAIV
Ga0182121_110683823300015316Switchgrass PhyllosphereMASPWVAGVKIVGRKLKMIRDKSCGVEKLLKDSFSMDSGGQGRSKEKKKIRG*
Ga0182136_102396723300015317Switchgrass PhyllosphereMASPWVAGVKIAGRKVKMIRDKSHRVERLLKDSSSMGSGGQGRRKEK*
Ga0182181_106457513300015318Switchgrass PhyllosphereMVFPWVAGVKIAGTKLKMIRDKSRGVEKLLKDSFSMDSGGQDRRKEKKKIRGR
Ga0182130_108048113300015319Switchgrass PhyllosphereMDSPWVVGVKIAGRKLKMIWDKSCSVEKLLKDSSSMGSGGQGRRK
Ga0182130_111495413300015319Switchgrass PhyllosphereMDSPWVVGVKIAGRKLKMIRDKSYRVKKLLKDSSSMGSWGQGRRKEK*
Ga0182165_112681323300015320Switchgrass PhyllosphereMASPWVAGVQIAGRKLKMIRYKSCRVEKLLKDSSSRDSGGQGRRKEKQRIQGRLGSK
Ga0182134_103483513300015324Switchgrass PhyllosphereMASPWVAGVKIAGRKLKMIWDKSRGVEKLLKDSFSMDSGGQGRRKEKKKIRG*
Ga0182134_104360313300015324Switchgrass PhyllosphereMASPWVIEVKIAGRKLKMIRDESRRAEKLLKNSSSMGSGGQGRRKEKQNI*
Ga0182134_104834213300015324Switchgrass PhyllosphereMASLWVAGVKIAGRKLKMIRDKSRRVEKLLKDSSSMGSGGQGRREEKQRI*
Ga0182148_104168633300015325Switchgrass PhyllosphereMASPWVAGVKIAGRKLKMIRDESRRTEKLLKNSSSMGSGGQGRRKEKQNI*
Ga0182166_102934423300015326Switchgrass PhyllosphereMASPWVAEVKIAGRKLKMIRDKSRRVEKLLKDSSSMGSGGQGRRKEKQRIRG*
Ga0182153_103116923300015328Switchgrass PhyllosphereMASLWVAGVKIAARKLKMMRDKSHRVEKLLKNNSSMGSGGQGRRKENQRIR
Ga0182153_108417213300015328Switchgrass PhyllosphereMASPWVAGVKKAGIKVKMIRDKSRGVEKLLKECSSMGSGGQG
Ga0182153_111316513300015328Switchgrass PhyllosphereMASPWVAGAKIAGRKLKMIRDKYRAVKKLLKDSSSMSSRGQGRRKEKQRYEDD*
Ga0182153_114674923300015328Switchgrass PhyllosphereMASPWVAEVKIAGRKLKMIRDKSRRVEKLLKDSSYMGSGGQGRRKEKQRI
Ga0182135_104186713300015329Switchgrass PhyllosphereMASPWVAGVKIAGRKLKMIRNKSRRAEKLLKDSSSMGSGGQGGRKEK*
Ga0182135_109914013300015329Switchgrass PhyllosphereMASPWVAGVKIAERKVKLIQDKSRRVEKLFKDIFSLDSGGQGRRKEK
Ga0182135_112452823300015329Switchgrass PhyllosphereMIAGVKIAERKLKMIWIKYRRVERLLKGSFSMDNGGQGR*
Ga0182147_116930313300015333Switchgrass PhyllosphereMAYPSVAGVKIAERKVKLIQDKSRRVEKLFKDIFSLDSGGQGRRKEKQRVRG*
Ga0182132_110111023300015334Switchgrass PhyllosphereMASPWVAGVKIAGRKLKMIRDKSRRVEKLLKDSSSMGSGGQGRRKEKQRI*
Ga0182132_114601523300015334Switchgrass PhyllosphereMASPWVAGVKIAERKVKMIWDKSRGVEKLLKDSFSMDSGGSR*
Ga0182150_103519223300015336Switchgrass PhyllosphereMASPWVAGVKIAGRKLKMIRDKSCREKLLKDSSSMGSGGQG
Ga0182150_106526323300015336Switchgrass PhyllosphereMASPWVAGLNIAERKLRMTRDKSRRVDKLLKDSFSMD
Ga0182151_110841313300015337Switchgrass PhyllosphereMASPWIAGVKVAGMKIKMVRNKSRRIEKLLKDSFPMDSGGQCRRKRKAKDMRTT
Ga0182151_112881213300015337Switchgrass PhyllosphereMASPWVVGVKIARRKLKMILGKSRRVEKLLKDSSSIGSGGQGRR
Ga0182137_108458123300015338Switchgrass PhyllosphereMASPWVAWVKIAGRKVKMIRDKSRGVEKLLKDSSSMGSEGQGRRKEKQRIRG*
Ga0182137_109267613300015338Switchgrass PhyllosphereMASPWVAGIKIAERKLKMICNKSHRIENLLKDSSSLGSGGQGRRKEKQRIR
Ga0182137_109492833300015338Switchgrass PhyllosphereMASPWVAGVKIVGRKLKMMRDKSRRVEKLLKDSSSMGSGGQGRRKEK
Ga0182115_108446013300015348Switchgrass PhyllosphereMDSPWVVGVKIAGRKLKMIRDKSCSVEKLLKDSSSMGSGGQGRRKE
Ga0182185_121007313300015349Switchgrass PhyllosphereMASPWVVGVKIAERKLKMIWDKSHRVEKLLKDNFSMDSGGQGRRKEKRKIRGRLGT
Ga0182163_125814723300015350Switchgrass PhyllosphereMASPWVAGIKIAGRKLKIIQDKSRGVEKLFKDSSTMGSGGQ
Ga0182169_106553623300015352Switchgrass PhyllosphereMASPWIAGVKVAGMKIKMVRNKSRRIEKLLKDSFPMDSGGQCRRKRKAKDMRTTR*
Ga0182169_118205623300015352Switchgrass PhyllosphereMASPWVAGVKIAGRKLKMIRDKSCRVEKLLKNSSSMGSGGQGIRKEKQRIR*
Ga0182169_120775323300015352Switchgrass PhyllosphereMASPWVAGVKIAERKLKMMWDKSRRVEKLLKDSFSMDSGGQGRRKEK
Ga0182169_131426313300015352Switchgrass PhyllosphereASPWVAGVKIAERKLKMMWDKSRRVEKLLKDSFSMDSGGQGRRKEKNRKRYEDD*
Ga0182179_108416723300015353Switchgrass PhyllosphereMASPWVAGVKIAERKLKMIRNKFRRIEKLFKDRFSLDSGRQGRRKEKQRY
Ga0182179_108997323300015353Switchgrass PhyllosphereMASPWVAGVKIAERKLKMMWDKSRRVEKLLKDSFSMDSGGQGRRKEKNRKRYEDD*
Ga0182179_109550113300015353Switchgrass PhyllosphereMASPWVAVVKIARRKLKMIRDKSRRVEKLLKDSSSMGSGGQ
Ga0182167_125936533300015354Switchgrass PhyllosphereMAYPWVAGVKIAERKVKLIQDKSRRVEKLFKDIFSLDSGGQGRRKEKQRVRG*
Ga0182167_134219523300015354Switchgrass PhyllosphereMASPWVVGVKIAGRKLKMIRDKSYRVKKLLKDSSSMGSWGQGRRKEK*
Ga0182167_135464013300015354Switchgrass PhyllosphereMASPWVAGVKIVGRKLKMIRDKSRRVEKLLKDSSFMGSGGQGRRKEKQRI*
Ga0182195_103180933300017414Switchgrass PhyllosphereMIAGVRVAGRKLKMIRDKSRRVEKLLKDSSSMGSGGQGR
Ga0182213_109007533300017421Switchgrass PhyllosphereMASPWVAGVKIAGRKLKMIQDKSRRVEKLLKDSSSMGSGGQG
Ga0182213_117877913300017421Switchgrass PhyllosphereMASPWVVGVKIAGRKLKMIRNEFRRIEKLFKDSFSLDSGGQGRRKEKKRIRGRLGSK
Ga0182201_108658823300017422Switchgrass PhyllosphereMASPWVAGVKIAGRILKMIRDKSRRVEELLKDSSSMGSGG
Ga0182196_102721223300017432Switchgrass PhyllosphereMASPWVAGVKIVGRKLKMIRDKSRGVEKLLKDSFSMDSGGQGRRKEKKKI
Ga0182196_114804613300017432Switchgrass PhyllosphereMASPWVARVKIAGRKLKMIQDKSRMVEELLKDSSSMGSGGQGRRKENQRV
Ga0182200_110195513300017439Switchgrass PhyllosphereMASPWVARVKIAVRKLKMIQDKSRRVDKLLKDSSSLGSGGQGRRKEK
Ga0182214_107811613300017440Switchgrass PhyllosphereMASLWIVGLKIAGRKLKMIRDKSHRVEKLLKDSFSMDSGGQGRRKESKRYEDN
Ga0182198_119088623300017445Switchgrass PhyllosphereMASPWVAGVKIAERKLKMIRNKFCRIEKLFKDSSSMDSEGQGRRKKNRKIYEDD
Ga0182215_110806723300017447Switchgrass PhyllosphereMASPWVVGVKIAERKLKMIRNKFRRIEKLFKGNFSMDSGGKGRRKKKGKDTRKTR
Ga0182215_115224613300017447Switchgrass PhyllosphereVAGVKIAERKLKMIRDKSHGVEKLLKDISSMGSRGQGRRKEKEKIKG
Ga0182212_116673613300017691Switchgrass PhyllosphereLRQRGYERTPSPWVAGVKIAGRKLKMIPDKSHRVEKLLKDSSSMGSGGQGGRKEK
Ga0182210_108871123300017692Switchgrass PhyllosphereMASPWVAGVKIAERKLKMIQNKFRRIEKLFKDIFSLDSGGQGRRKQKQRYEDD
Ga0182216_113571413300017693Switchgrass PhyllosphereMASPWVAEVKIAGRKLKMIRDKSRRVEKLLKDSSSMGSGG
Ga0182211_115849813300017694Switchgrass PhyllosphereMASLWVAGVKIANKKLKIIRNISRRAEKILKNSFSMDN
Ga0182211_116591823300017694Switchgrass PhyllosphereMASPWVAGVKIAGRKLKMIRNEFCRIEKLFKDSFSLDSGGQGRR
Ga0213505_11677313300022465Switchgrass PhyllosphereAGVKIAGRKLKMIWDKSHRVEKLLKDSSSMASGGQGRRKEKQRLRDFFFGR
Ga0207646_1086530313300025922Corn, Switchgrass And Miscanthus RhizosphereMPSPWVAGVKIAGRKLKMIRDKSRRVEKLLKDSSSTGSGGQGRRKEKQRIRGRLGWKK
Ga0268328_104543423300028050PhyllosphereMASPWVAGLNIAERKLRMTRDKSRRVDKLLKDSFSMDSRGQGRRKEKERIR
Ga0268344_101530623300028051PhyllosphereMASPWVAGVKIAGRKQKMIRDKSRRVEKLLKDSSSMDSGGQGRRKEKGKYTRTT
Ga0268300_100491413300028052PhyllosphereMASPWVAGVKIAGRKLKMMRDKSCRVEKLLKDSSSMGSGGQGRRKEKKNI
Ga0268346_100587113300028053PhyllosphereMASPWVAGMKIVERKLNMIRDKSRGVEKLLKDSFSMDSGGQGRRKEKKKI
Ga0268346_100624013300028053PhyllosphereMASPWVAGVKIAGKKLKMIRDKSRGVEKLLKDSFSMDSGGQDRRK
Ga0268346_101005513300028053PhyllosphereMASPWVAGVKIAGRKLKMMRDKYHRIEKLLKDNSSMGSRGQGRRQEYEDD
Ga0268338_100675213300028055PhyllosphereKIVGRKLKMIRNKFCRIEKLFKDSFSLDSRGQGRRKEKQRIRG
Ga0268330_105632313300028056PhyllosphereMASPWVAGVKIAGKKLRKTRNEFRRVETLLKDSFSMGSWNKDRRKKRNDTRITR
Ga0268332_103177333300028058PhyllosphereMASPWVAGVQIAGRKLKMIRYKSCRVEKLLKDSSSRDSGGQGRRKEKQRIQGRLG
Ga0268332_104406513300028058PhyllosphereMASPWVAGVKIAGRKLKMMRDKYHRIEKLLKDNSSMGSRGQ
Ga0268347_102477113300028142PhyllosphereMASPWVAGVKIAGRKLKMIRDKSRGVEKLLKDSSSM
Ga0268345_102311923300028144PhyllosphereMASPWVAGVKIAGRKLKMIRDKSHRVEKLLKDSSSMGSGGQGRRKEKQRI
Ga0268336_100398423300028152PhyllosphereMASPWVAGVKIAERKVKMIWDKSRGVEKLLKDSFSMDSGG
Ga0268341_100299523300028154PhyllosphereMASPWVAGVKIAGRKLKMIQDKSRRVEKLLKDSSSMGS
Ga0268316_100333123300028253PhyllosphereMDTLWVAGVKIAERKLKMIRDKSRRVEKLLKDSSSMGSGGQGRRKEKQRIRGR
Ga0268337_101906913300028469PhyllosphereMASPWVAGVKIAERKLKMMWDKSRRVEKLLKDSLSMDSGGQGRRK
Ga0268339_101095523300028526PhyllosphereMASPWVVGVKIAGRKLKMIRDKSCSVEKLLKDSSSMGSGGQGRRKEKQKIRGRLGLKK
Ga0214493_106580723300032465Switchgrass PhyllosphereMASPWVAGIKIAGKKQKMIRYKYHGVEKLLKDSLSIDSGGQGRI
Ga0214490_105511513300032502Switchgrass PhyllosphereMKRMASPWVAGVKIAGRKLKMIRDKSRRVEKLLNYSSSRGSGGQGRRKEKQRI
Ga0214490_112232413300032502Switchgrass PhyllosphereMASPLIAGVKIAERKLKMIRDKSHRVEKLLKDSFSIDSGGQGRRK
Ga0214504_100117113300032592Switchgrass PhyllosphereMASPWVVGVKIAGRKLKMIRDKSCGVEKLLKDSSSMGSGGQGRRKEKQRYEDD
Ga0314743_114693513300032844Switchgrass PhyllosphereMDSPWVAGVKIAGKKLKMILDKSRGVEKLLKDSPSMGSGGQGRRKEKQRI
Ga0314759_100081673300033535Switchgrass PhyllosphereMDSPWVAGVKIAGKKLKMILDKSRGVEKLLKDSPSMGSGGQGRRKEKQRIRGRLGSKKD


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.