Scaffold Ga0335397_10035499

Overview

Basic Information

• Taxon OID: 3300032420
• Scaffold ID: Ga0335397_10035499
• Source Dataset Name: Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - MAT-04 (spades assembly)
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 5653
• Total Scaffold Genes: 10
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 7 (70.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Freshwater → Ice → Glacial Lake → Freshwater → Freshwater Microbial Communities From Lake Liftoff Mats And Glacier Meltwater In Antarctica

Source Dataset Sampling Location

• Location Name: Lake Fryxell
• Coordinates
  • Lat. (^o): -77.605
  • Long. (^o): 163.163
  • Depth (m): 0

Associated Families

Family	Category	Number of Sequences	3D Structure?
F105531	Metagenome / Metatranscriptome	100	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0335397_100354999	F105531	AGGAG	MKGFFLASAVAVTLALGMSTAADAKVKIYLGVPHYDYQYGPDYRFREGYGWYQYSGYNDYNRGRLSCGEARRVVRNNGYRNVNTIECRGPTYTFEATRRGRDVTVFVNSRNGRMWRG