Scaffold Ga0334665_111500

Overview

Basic Information

• Taxon OID: 3300032209
• Scaffold ID: Ga0334665_111500
• Source Dataset Name: Metatranscriptome of plant-associated microbial communities from Arabidopsis thaliana in University of Tennessee, Knoxville, TN, United States - Col_370_1 (Metagenome Metatranscriptome) (v2)
• Source Dataset Category: Metatranscriptome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1072
• Total Scaffold Genes: 1
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Host-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated → Aquatic Microbiome From Duckweeds Obtained From Rutgers Duckweed Stock Cooperative (rdsc)

Source Dataset Sampling Location

• Location Name: USA: Knoxville, Tennessee
• Coordinates
  • Lat. (^o): 35.9573
  • Long. (^o): -83.9276

Associated Families

Family	Category	Number of Sequences	3D Structure?
F037234	Metagenome / Metatranscriptome	168	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0334665_1115001	F037234	N/A	NYEKMNKYLGLDPKASDLTMIRVVKARTGYRCKDIR