Scaffold Ga0315303_1075545

Overview

Basic Information

• Taxon OID: 3300032146
• Scaffold ID: Ga0315303_1075545
• Source Dataset Name: Metatranscriptome of marine microbial communities from Western Arctic Ocean, Canada - CBN3_Tmax_316 (Metagenome Metatranscriptome)
• Source Dataset Category: Metatranscriptome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 690
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (50.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium TMED8 (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Microbial Communities From Western Arctic Ocean, Canada

Source Dataset Sampling Location

• Location Name: Canada: Western Arctic Ocean
• Coordinates
  • Lat. (^o): 80.9595
  • Long. (^o): -132.1842
  • Depth (m): 370

Associated Families

Family	Category	Number of Sequences	3D Structure?
F030120	Metagenome / Metatranscriptome	186	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0315303_10755451	F030120	GAG	MATFIDRVVKSETRYEPGPLPEGVEDLGNYVVTELKRIGSIFL