| Basic Information | |
|---|---|
| Family ID | F030120 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 186 |
| Average Sequence Length | 42 residues |
| Representative Sequence | MATYKDRVVKSVTYYEPGPLPLDQEDLGIYVVTELKRLGN |
| Number of Associated Samples | 110 |
| Number of Associated Scaffolds | 186 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 89.73 % |
| % of genes near scaffold ends (potentially truncated) | 97.31 % |
| % of genes from short scaffolds (< 2000 bps) | 92.47 % |
| Associated GOLD sequencing projects | 84 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.50 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (47.849 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine (42.473 % of family members) |
| Environment Ontology (ENVO) | Unclassified (95.161 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) (83.871 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 27.94% β-sheet: 0.00% Coil/Unstructured: 72.06% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.50 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 186 Family Scaffolds |
|---|---|---|
| PF09636 | XkdW | 0.54 |
| PF13884 | Peptidase_S74 | 0.54 |
| PF13640 | 2OG-FeII_Oxy_3 | 0.54 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 68.28 % |
| Unclassified | root | N/A | 31.72 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300002484|JGI25129J35166_1070911 | Not Available | 639 | Open in IMG/M |
| 3300002511|JGI25131J35506_1005811 | All Organisms → Viruses → Predicted Viral | 1743 | Open in IMG/M |
| 3300002514|JGI25133J35611_10077786 | Not Available | 1028 | Open in IMG/M |
| 3300002518|JGI25134J35505_10077832 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium TMED8 | 761 | Open in IMG/M |
| 3300002518|JGI25134J35505_10128899 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium TMED8 | 529 | Open in IMG/M |
| 3300002519|JGI25130J35507_1010982 | All Organisms → Viruses → Predicted Viral | 2268 | Open in IMG/M |
| 3300002519|JGI25130J35507_1096215 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium TMED8 | 540 | Open in IMG/M |
| 3300002519|JGI25130J35507_1105536 | Not Available | 508 | Open in IMG/M |
| 3300002760|JGI25136J39404_1005979 | All Organisms → Viruses → Predicted Viral | 2095 | Open in IMG/M |
| 3300002760|JGI25136J39404_1017870 | All Organisms → Viruses → Predicted Viral | 1280 | Open in IMG/M |
| 3300002760|JGI25136J39404_1028615 | Not Available | 1018 | Open in IMG/M |
| 3300005426|Ga0066847_10095018 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium TMED8 | 934 | Open in IMG/M |
| 3300005551|Ga0066843_10194688 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium TMED8 | 570 | Open in IMG/M |
| 3300005596|Ga0066834_10170817 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium TMED8 | 695 | Open in IMG/M |
| 3300006076|Ga0081592_1036079 | All Organisms → Viruses → Predicted Viral | 2413 | Open in IMG/M |
| 3300006310|Ga0068471_1244098 | All Organisms → Viruses → Predicted Viral | 1815 | Open in IMG/M |
| 3300006310|Ga0068471_1432629 | All Organisms → Viruses → Predicted Viral | 1743 | Open in IMG/M |
| 3300006339|Ga0068481_1479157 | All Organisms → Viruses → Predicted Viral | 1779 | Open in IMG/M |
| 3300006340|Ga0068503_10251287 | All Organisms → Viruses → Predicted Viral | 1539 | Open in IMG/M |
| 3300006340|Ga0068503_10251288 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium TMED8 | 672 | Open in IMG/M |
| 3300006340|Ga0068503_10393152 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium TMED8 | 572 | Open in IMG/M |
| 3300006726|Ga0098070_105642 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium TMED8 | 754 | Open in IMG/M |
| 3300006736|Ga0098033_1065857 | Not Available | 1051 | Open in IMG/M |
| 3300006736|Ga0098033_1079138 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium TMED8 | 946 | Open in IMG/M |
| 3300006738|Ga0098035_1164262 | Not Available | 751 | Open in IMG/M |
| 3300006750|Ga0098058_1013584 | All Organisms → Viruses → Predicted Viral | 2418 | Open in IMG/M |
| 3300006751|Ga0098040_1022772 | All Organisms → Viruses → Predicted Viral | 2036 | Open in IMG/M |
| 3300006751|Ga0098040_1035166 | All Organisms → Viruses → Predicted Viral | 1591 | Open in IMG/M |
| 3300006754|Ga0098044_1278535 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium TMED8 | 643 | Open in IMG/M |
| 3300006754|Ga0098044_1344704 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium TMED8 | 565 | Open in IMG/M |
| 3300006793|Ga0098055_1088498 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium TMED8 | 1215 | Open in IMG/M |
| 3300006926|Ga0098057_1022606 | All Organisms → Viruses → Predicted Viral | 1581 | Open in IMG/M |
| 3300006927|Ga0098034_1067796 | All Organisms → Viruses → Predicted Viral | 1037 | Open in IMG/M |
| 3300006927|Ga0098034_1084426 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium TMED8 | 915 | Open in IMG/M |
| 3300006929|Ga0098036_1183822 | Not Available | 636 | Open in IMG/M |
| 3300007963|Ga0110931_1072646 | All Organisms → Viruses → Predicted Viral | 1039 | Open in IMG/M |
| 3300007963|Ga0110931_1104538 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium TMED8 | 854 | Open in IMG/M |
| 3300007963|Ga0110931_1213288 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium TMED8 | 576 | Open in IMG/M |
| 3300007963|Ga0110931_1253527 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium TMED8 | 523 | Open in IMG/M |
| 3300008050|Ga0098052_1309535 | Not Available | 596 | Open in IMG/M |
| 3300008051|Ga0098062_1063077 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium TMED8 | 515 | Open in IMG/M |
| 3300008216|Ga0114898_1081098 | Not Available | 991 | Open in IMG/M |
| 3300008217|Ga0114899_1053762 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium TMED8 | 1429 | Open in IMG/M |
| 3300008217|Ga0114899_1161702 | Not Available | 724 | Open in IMG/M |
| 3300008217|Ga0114899_1194718 | Not Available | 645 | Open in IMG/M |
| 3300008217|Ga0114899_1257400 | Not Available | 535 | Open in IMG/M |
| 3300008218|Ga0114904_1006572 | All Organisms → Viruses → Predicted Viral | 4291 | Open in IMG/M |
| 3300008218|Ga0114904_1078848 | Not Available | 822 | Open in IMG/M |
| 3300008218|Ga0114904_1093363 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium TMED8 | 738 | Open in IMG/M |
| 3300008219|Ga0114905_1092963 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium TMED8 | 1053 | Open in IMG/M |
| 3300008219|Ga0114905_1109447 | Not Available | 950 | Open in IMG/M |
| 3300008219|Ga0114905_1135433 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium TMED8 | 831 | Open in IMG/M |
| 3300008219|Ga0114905_1221750 | Not Available | 603 | Open in IMG/M |
| 3300008220|Ga0114910_1032674 | All Organisms → Viruses → Predicted Viral | 1745 | Open in IMG/M |
| 3300008220|Ga0114910_1103933 | Not Available | 844 | Open in IMG/M |
| 3300008220|Ga0114910_1134646 | Not Available | 713 | Open in IMG/M |
| 3300008220|Ga0114910_1183776 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium TMED8 | 582 | Open in IMG/M |
| 3300009412|Ga0114903_1033735 | Not Available | 1256 | Open in IMG/M |
| 3300009412|Ga0114903_1124013 | Not Available | 567 | Open in IMG/M |
| 3300009412|Ga0114903_1147678 | Not Available | 513 | Open in IMG/M |
| 3300009414|Ga0114909_1020370 | All Organisms → Viruses → Predicted Viral | 2182 | Open in IMG/M |
| 3300009418|Ga0114908_1142232 | Not Available | 774 | Open in IMG/M |
| 3300009418|Ga0114908_1170168 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium TMED8 | 690 | Open in IMG/M |
| 3300009418|Ga0114908_1235131 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium TMED8 | 561 | Open in IMG/M |
| 3300009481|Ga0114932_10512219 | Not Available | 706 | Open in IMG/M |
| 3300009481|Ga0114932_10741209 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium TMED8 | 571 | Open in IMG/M |
| 3300009595|Ga0105214_106247 | Not Available | 756 | Open in IMG/M |
| 3300009602|Ga0114900_1061572 | All Organisms → Viruses → Predicted Viral | 1114 | Open in IMG/M |
| 3300009603|Ga0114911_1142223 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium TMED8 | 676 | Open in IMG/M |
| 3300009603|Ga0114911_1215247 | Not Available | 517 | Open in IMG/M |
| 3300009604|Ga0114901_1182277 | Not Available | 617 | Open in IMG/M |
| 3300009605|Ga0114906_1081263 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium TMED8 | 1186 | Open in IMG/M |
| 3300009605|Ga0114906_1106226 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium TMED8 | 1004 | Open in IMG/M |
| 3300009619|Ga0105236_1012827 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium TMED8 | 910 | Open in IMG/M |
| 3300009620|Ga0114912_1155695 | Not Available | 532 | Open in IMG/M |
| 3300009791|Ga0105235_115137 | Not Available | 856 | Open in IMG/M |
| 3300010150|Ga0098056_1190697 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium TMED8 | 686 | Open in IMG/M |
| 3300010151|Ga0098061_1135336 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium TMED8 | 900 | Open in IMG/M |
| 3300010155|Ga0098047_10022096 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium TMED8 | 2555 | Open in IMG/M |
| 3300010155|Ga0098047_10068940 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium TMED8 | 1387 | Open in IMG/M |
| 3300010155|Ga0098047_10301008 | Not Available | 606 | Open in IMG/M |
| 3300017775|Ga0181432_1088859 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium TMED8 | 910 | Open in IMG/M |
| 3300017775|Ga0181432_1303174 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium TMED8 | 507 | Open in IMG/M |
| 3300020383|Ga0211646_10297167 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium TMED8 | 571 | Open in IMG/M |
| 3300020425|Ga0211549_10060058 | All Organisms → Viruses → Predicted Viral | 1426 | Open in IMG/M |
| 3300021791|Ga0226832_10152455 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium TMED8 | 879 | Open in IMG/M |
| 3300021791|Ga0226832_10164375 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium TMED8 | 850 | Open in IMG/M |
| 3300021979|Ga0232641_1139680 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium TMED8 | 920 | Open in IMG/M |
| 3300023500|Ga0257021_1076663 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium TMED8 | 783 | Open in IMG/M |
| (restricted) 3300024517|Ga0255049_10199523 | Not Available | 914 | Open in IMG/M |
| (restricted) 3300024518|Ga0255048_10179830 | All Organisms → Viruses → Predicted Viral | 1035 | Open in IMG/M |
| (restricted) 3300024518|Ga0255048_10241925 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium TMED8 | 877 | Open in IMG/M |
| 3300025042|Ga0207889_1013466 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium TMED8 | 760 | Open in IMG/M |
| 3300025042|Ga0207889_1020400 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium TMED8 | 619 | Open in IMG/M |
| 3300025043|Ga0207907_128224 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium TMED8 | 507 | Open in IMG/M |
| 3300025044|Ga0207891_1023632 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium TMED8 | 768 | Open in IMG/M |
| 3300025045|Ga0207901_1010156 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium TMED8 | 1318 | Open in IMG/M |
| 3300025046|Ga0207902_1036769 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium TMED8 | 606 | Open in IMG/M |
| 3300025050|Ga0207892_1027156 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium TMED8 | 652 | Open in IMG/M |
| 3300025052|Ga0207906_1012672 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium TMED8 | 1181 | Open in IMG/M |
| 3300025052|Ga0207906_1055064 | Not Available | 528 | Open in IMG/M |
| 3300025069|Ga0207887_1057827 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium TMED8 | 633 | Open in IMG/M |
| 3300025069|Ga0207887_1058536 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium TMED8 | 629 | Open in IMG/M |
| 3300025096|Ga0208011_1022324 | All Organisms → Viruses → Predicted Viral | 1616 | Open in IMG/M |
| 3300025096|Ga0208011_1036386 | All Organisms → Viruses → Predicted Viral | 1185 | Open in IMG/M |
| 3300025108|Ga0208793_1173824 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium TMED8 | 555 | Open in IMG/M |
| 3300025109|Ga0208553_1097666 | Not Available | 683 | Open in IMG/M |
| 3300025112|Ga0209349_1035977 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium TMED8 | 1626 | Open in IMG/M |
| 3300025112|Ga0209349_1137983 | Not Available | 666 | Open in IMG/M |
| 3300025114|Ga0208433_1035895 | All Organisms → Viruses → Predicted Viral | 1358 | Open in IMG/M |
| 3300025118|Ga0208790_1054302 | All Organisms → Viruses → Predicted Viral | 1251 | Open in IMG/M |
| 3300025125|Ga0209644_1066044 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium TMED8 | 839 | Open in IMG/M |
| 3300025125|Ga0209644_1097482 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium TMED8 | 694 | Open in IMG/M |
| 3300025125|Ga0209644_1098952 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium TMED8 | 689 | Open in IMG/M |
| 3300025128|Ga0208919_1107240 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium TMED8 | 895 | Open in IMG/M |
| 3300025128|Ga0208919_1232509 | Not Available | 541 | Open in IMG/M |
| 3300025131|Ga0209128_1092741 | Not Available | 989 | Open in IMG/M |
| 3300025133|Ga0208299_1164448 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium TMED8 | 686 | Open in IMG/M |
| 3300025133|Ga0208299_1186517 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium TMED8 | 625 | Open in IMG/M |
| 3300025141|Ga0209756_1123982 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium TMED8 | 1076 | Open in IMG/M |
| 3300025241|Ga0207893_1044137 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium TMED8 | 638 | Open in IMG/M |
| 3300025251|Ga0208182_1030801 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium TMED8 | 1228 | Open in IMG/M |
| 3300025264|Ga0208029_1013369 | All Organisms → Viruses → Predicted Viral | 2204 | Open in IMG/M |
| 3300025267|Ga0208179_1024795 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium TMED8 | 1582 | Open in IMG/M |
| 3300025270|Ga0208813_1082775 | Not Available | 660 | Open in IMG/M |
| 3300025274|Ga0208183_1096067 | Not Available | 545 | Open in IMG/M |
| 3300025277|Ga0208180_1073302 | Not Available | 816 | Open in IMG/M |
| 3300025277|Ga0208180_1087255 | Not Available | 716 | Open in IMG/M |
| 3300025277|Ga0208180_1123549 | Not Available | 549 | Open in IMG/M |
| 3300025280|Ga0208449_1027539 | All Organisms → Viruses → Predicted Viral | 1707 | Open in IMG/M |
| 3300025280|Ga0208449_1083808 | Not Available | 781 | Open in IMG/M |
| 3300025280|Ga0208449_1091017 | Not Available | 735 | Open in IMG/M |
| 3300025282|Ga0208030_1006177 | Not Available | 4853 | Open in IMG/M |
| 3300025282|Ga0208030_1161304 | Not Available | 520 | Open in IMG/M |
| 3300025286|Ga0208315_1003455 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 6695 | Open in IMG/M |
| 3300025286|Ga0208315_1057549 | All Organisms → Viruses → Predicted Viral | 1010 | Open in IMG/M |
| 3300025286|Ga0208315_1065564 | Not Available | 924 | Open in IMG/M |
| 3300025286|Ga0208315_1091246 | Not Available | 735 | Open in IMG/M |
| 3300025286|Ga0208315_1103284 | Not Available | 675 | Open in IMG/M |
| 3300025286|Ga0208315_1106393 | Not Available | 661 | Open in IMG/M |
| 3300025287|Ga0207903_1084636 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium TMED8 | 537 | Open in IMG/M |
| 3300025293|Ga0208934_1046681 | Not Available | 800 | Open in IMG/M |
| 3300025296|Ga0208316_1054337 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium TMED8 | 821 | Open in IMG/M |
| 3300025296|Ga0208316_1062440 | Not Available | 740 | Open in IMG/M |
| 3300025300|Ga0208181_1039281 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium TMED8 | 1023 | Open in IMG/M |
| 3300025301|Ga0208450_1020127 | All Organisms → Viruses → Predicted Viral | 1937 | Open in IMG/M |
| 3300025301|Ga0208450_1059840 | Not Available | 912 | Open in IMG/M |
| 3300025305|Ga0208684_1010507 | All Organisms → Viruses → Predicted Viral | 3277 | Open in IMG/M |
| 3300025305|Ga0208684_1028204 | All Organisms → Viruses → Predicted Viral | 1687 | Open in IMG/M |
| 3300025305|Ga0208684_1035023 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium TMED8 | 1461 | Open in IMG/M |
| 3300025305|Ga0208684_1117811 | Not Available | 648 | Open in IMG/M |
| 3300025770|Ga0209362_1253273 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium TMED8 | 568 | Open in IMG/M |
| 3300025873|Ga0209757_10026608 | All Organisms → Viruses → Predicted Viral | 1632 | Open in IMG/M |
| 3300025873|Ga0209757_10092685 | Not Available | 920 | Open in IMG/M |
| 3300025873|Ga0209757_10121160 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium TMED8 | 809 | Open in IMG/M |
| 3300025873|Ga0209757_10136561 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium TMED8 | 764 | Open in IMG/M |
| 3300025873|Ga0209757_10153293 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium TMED8 | 722 | Open in IMG/M |
| 3300025873|Ga0209757_10309077 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium TMED8 | 503 | Open in IMG/M |
| 3300026202|Ga0207984_1026710 | All Organisms → Viruses → Predicted Viral | 1673 | Open in IMG/M |
| 3300027838|Ga0209089_10692765 | Not Available | 523 | Open in IMG/M |
| 3300028018|Ga0256381_1036247 | Not Available | 785 | Open in IMG/M |
| 3300028022|Ga0256382_1098459 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium TMED8 | 701 | Open in IMG/M |
| 3300028022|Ga0256382_1106523 | Not Available | 673 | Open in IMG/M |
| 3300028039|Ga0256380_1057184 | Not Available | 582 | Open in IMG/M |
| 3300031625|Ga0302135_10423818 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium TMED8 | 506 | Open in IMG/M |
| 3300031701|Ga0302120_10231989 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium TMED8 | 694 | Open in IMG/M |
| 3300031757|Ga0315328_10200387 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium TMED8 | 1167 | Open in IMG/M |
| 3300031802|Ga0310123_10890373 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium TMED8 | 524 | Open in IMG/M |
| 3300032006|Ga0310344_10178617 | All Organisms → Viruses → Predicted Viral | 1801 | Open in IMG/M |
| 3300032146|Ga0315303_1075545 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium TMED8 | 690 | Open in IMG/M |
| 3300032146|Ga0315303_1131957 | Not Available | 515 | Open in IMG/M |
| 3300032278|Ga0310345_10520863 | All Organisms → Viruses → Predicted Viral | 1137 | Open in IMG/M |
| 3300032278|Ga0310345_11132268 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium TMED8 | 765 | Open in IMG/M |
| 3300032360|Ga0315334_11550092 | Not Available | 567 | Open in IMG/M |
| 3300032820|Ga0310342_100135741 | All Organisms → Viruses → Predicted Viral | 2368 | Open in IMG/M |
| 3300032820|Ga0310342_100851561 | All Organisms → Viruses → Predicted Viral | 1059 | Open in IMG/M |
| 3300032820|Ga0310342_101347871 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium TMED8 | 846 | Open in IMG/M |
| 3300034628|Ga0326755_017110 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium TMED8 | 702 | Open in IMG/M |
| 3300034629|Ga0326756_004639 | All Organisms → Viruses → Predicted Viral | 1596 | Open in IMG/M |
| 3300034629|Ga0326756_036126 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium TMED8 | 601 | Open in IMG/M |
| 3300034654|Ga0326741_024161 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium TMED8 | 1072 | Open in IMG/M |
| 3300034654|Ga0326741_034426 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium TMED8 | 877 | Open in IMG/M |
| 3300034654|Ga0326741_085437 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium TMED8 | 518 | Open in IMG/M |
| 3300034656|Ga0326748_017395 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium TMED8 | 955 | Open in IMG/M |
| 3300034658|Ga0326751_026213 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium TMED8 | 578 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 42.47% |
| Deep Ocean | Environmental → Aquatic → Marine → Oceanic → Unclassified → Deep Ocean | 33.33% |
| Filtered Seawater | Environmental → Aquatic → Marine → Unclassified → Unclassified → Filtered Seawater | 4.30% |
| Seawater | Environmental → Aquatic → Marine → Oceanic → Unclassified → Seawater | 3.23% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Aphotic Zone → Marine | 2.69% |
| Seawater | Environmental → Aquatic → Marine → Pelagic → Unclassified → Seawater | 2.15% |
| Marine Oceanic | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine Oceanic | 1.61% |
| Seawater | Environmental → Aquatic → Marine → Inlet → Unclassified → Seawater | 1.61% |
| Hydrothermal Vent Fluids | Environmental → Aquatic → Marine → Hydrothermal Vents → Diffuse Flow → Hydrothermal Vent Fluids | 1.61% |
| Seawater | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Seawater | 1.08% |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 1.08% |
| Seawater | Environmental → Aquatic → Marine → Strait → Unclassified → Seawater | 1.08% |
| Deep Subsurface | Environmental → Aquatic → Marine → Volcanic → Unclassified → Deep Subsurface | 1.08% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 0.54% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Photic Zone → Marine | 0.54% |
| Marine | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine | 0.54% |
| Diffuse Hydrothermal Fluids | Environmental → Aquatic → Marine → Hydrothermal Vents → Diffuse Flow → Diffuse Hydrothermal Fluids | 0.54% |
| Marine | Environmental → Aquatic → Marine → Hydrothermal Vents → Microbial Mats → Marine | 0.54% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300002484 | Marine viral communities from the Pacific Ocean - ETNP_2_130 | Environmental | Open in IMG/M |
| 3300002511 | Marine viral communities from the Pacific Ocean - ETNP_2_1000 | Environmental | Open in IMG/M |
| 3300002514 | Marine viral communities from the Pacific Ocean - ETNP_6_85 | Environmental | Open in IMG/M |
| 3300002518 | Marine viral communities from the Pacific Ocean - ETNP_6_100 | Environmental | Open in IMG/M |
| 3300002519 | Marine viral communities from the Pacific Ocean - ETNP_2_300 | Environmental | Open in IMG/M |
| 3300002760 | Marine viral communities from the Pacific Ocean - ETNP_6_1000 | Environmental | Open in IMG/M |
| 3300005426 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201310SV74 | Environmental | Open in IMG/M |
| 3300005551 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201302PF89A | Environmental | Open in IMG/M |
| 3300005596 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201306PF43B | Environmental | Open in IMG/M |
| 3300006076 | Microbial communities in diffuse hydrothermal fluids of Manus Basin, Bismarck Sea ? fluid A | Environmental | Open in IMG/M |
| 3300006310 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT229_3_0500m | Environmental | Open in IMG/M |
| 3300006339 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT232_3_0500m | Environmental | Open in IMG/M |
| 3300006340 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT238_2_0770m | Environmental | Open in IMG/M |
| 3300006726 | Marine viral communities from Cariaco Basin, Caribbean Sea - 28_WHOI_OMZ | Environmental | Open in IMG/M |
| 3300006736 | Marine viral communities from the Subarctic Pacific Ocean - 1_ETSP_OMZ_AT15124 metaG | Environmental | Open in IMG/M |
| 3300006738 | Marine viral communities from the Subarctic Pacific Ocean - 3_ETSP_OMZ_AT15126 metaG | Environmental | Open in IMG/M |
| 3300006750 | Marine viral communities from the Subarctic Pacific Ocean - 19_ETSP_OMZ_AT15317 metaG | Environmental | Open in IMG/M |
| 3300006751 | Marine viral communities from the Subarctic Pacific Ocean - 7_ETSP_OMZ_AT15161 metaG | Environmental | Open in IMG/M |
| 3300006754 | Marine viral communities from the Subarctic Pacific Ocean - 10_ETSP_OMZ_AT15264 metaG | Environmental | Open in IMG/M |
| 3300006793 | Marine viral communities from the Subarctic Pacific Ocean - 17_ETSP_OMZ_AT15314 metaG | Environmental | Open in IMG/M |
| 3300006926 | Marine viral communities from the Subarctic Pacific Ocean - 18_ETSP_OMZAT15316 metaG | Environmental | Open in IMG/M |
| 3300006927 | Marine viral communities from the Subarctic Pacific Ocean - 2_ETSP_OMZ_AT15125 metaG | Environmental | Open in IMG/M |
| 3300006929 | Marine viral communities from the Subarctic Pacific Ocean - 4_ETSP_OMZ_AT15127 metaG | Environmental | Open in IMG/M |
| 3300007963 | Marine viral communities from the Subarctic Pacific Ocean - 4_ETSP_OMZ_AT15127 metaG (version 2) | Environmental | Open in IMG/M |
| 3300008050 | Marine viral communities from the Subarctic Pacific Ocean - 15_ETSP_OMZ_AT15312 metaG | Environmental | Open in IMG/M |
| 3300008051 | Marine viral communities from Cariaco Basin, Caribbean Sea - 23_WHOI_OMZ | Environmental | Open in IMG/M |
| 3300008216 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_Geostar | Environmental | Open in IMG/M |
| 3300008217 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_215 | Environmental | Open in IMG/M |
| 3300008218 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_s6 | Environmental | Open in IMG/M |
| 3300008219 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_b05 | Environmental | Open in IMG/M |
| 3300008220 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_908 | Environmental | Open in IMG/M |
| 3300009412 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_s2 | Environmental | Open in IMG/M |
| 3300009414 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_906 | Environmental | Open in IMG/M |
| 3300009418 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_s17 | Environmental | Open in IMG/M |
| 3300009481 | Deep subsurface microbial communities from Kolumbo volcano to uncover new lineages of life (NeLLi) - 2SBTROV12_ACTIVE470 metaG | Environmental | Open in IMG/M |
| 3300009595 | Marine viral communities from the Southern Atlantic ocean transect to study dissolved organic matter and carbon cycling - metaG 3635_2500 | Environmental | Open in IMG/M |
| 3300009602 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_231 | Environmental | Open in IMG/M |
| 3300009603 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_904 | Environmental | Open in IMG/M |
| 3300009604 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_s16 | Environmental | Open in IMG/M |
| 3300009605 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_M9 | Environmental | Open in IMG/M |
| 3300009619 | Marine viral communities from the Southern Atlantic ocean transect to study dissolved organic matter and carbon cycling - metaG 3827_250 | Environmental | Open in IMG/M |
| 3300009620 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_51 | Environmental | Open in IMG/M |
| 3300009791 | Marine viral communities from the Southern Atlantic ocean transect to study dissolved organic matter and carbon cycling - metaG 3819_2500 | Environmental | Open in IMG/M |
| 3300010150 | Marine viral communities from the Subarctic Pacific Ocean - 17B_ETSP_OMZ_AT15314_CsCl metaG | Environmental | Open in IMG/M |
| 3300010151 | Marine viral communities from the Subarctic Pacific Ocean - 22_ETSP_OMZ_AT15343 metaG | Environmental | Open in IMG/M |
| 3300010155 | Marine viral communities from the Subarctic Pacific Ocean - 12_ETSP_OMZ_AT15267 metaG | Environmental | Open in IMG/M |
| 3300017775 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 55 SPOT_SRF_2014-07-17 | Environmental | Open in IMG/M |
| 3300020383 | Marine microbial communities from Tara Oceans - TARA_B100000929 (ERX556043-ERR598971) | Environmental | Open in IMG/M |
| 3300020425 | Marine microbial communities from Tara Oceans - TARA_B100001765 (ERX556083-ERR598964) | Environmental | Open in IMG/M |
| 3300021791 | Hydrothermal fluids microbial communities from Mariana Back-Arc Basin vent fields, Pacific Ocean - Daikoku_FS921 150_kmer | Environmental | Open in IMG/M |
| 3300021979 | Hydrothermal fluids microbial communities from Mariana Back-Arc Basin vent fields, Pacific Ocean - Hafa_FS926 _150kmer | Environmental | Open in IMG/M |
| 3300023500 | Marine microbial mat from Loihi Seamount, Hawaii, USA - Marker 39_BS4 Individual Assembly | Environmental | Open in IMG/M |
| 3300024517 (restricted) | Seawater microbial communities from Jervis Inlet, British Columbia, Canada - JV7_2_3 | Environmental | Open in IMG/M |
| 3300024518 (restricted) | Seawater microbial communities from Jervis Inlet, British Columbia, Canada - JV7_2_2 | Environmental | Open in IMG/M |
| 3300025042 | Marine viral communities from the Pacific Ocean - LP-47 (SPAdes) | Environmental | Open in IMG/M |
| 3300025043 | Marine viral communities from the Subarctic Pacific Ocean - LP-52 (SPAdes) | Environmental | Open in IMG/M |
| 3300025044 | Marine viral communities from the Pacific Ocean - LP-50 (SPAdes) | Environmental | Open in IMG/M |
| 3300025045 | Marine viral communities from the Pacific Ocean - LP-46 (SPAdes) | Environmental | Open in IMG/M |
| 3300025046 | Marine viral communities from the Pacific Ocean - LP-45 (SPAdes) | Environmental | Open in IMG/M |
| 3300025050 | Marine viral communities from the Pacific Ocean - LP-54 (SPAdes) | Environmental | Open in IMG/M |
| 3300025052 | Marine viral communities from the Pacific Ocean - LP-37 (SPAdes) | Environmental | Open in IMG/M |
| 3300025069 | Marine viral communities from the Pacific Ocean - LP-38 (SPAdes) | Environmental | Open in IMG/M |
| 3300025096 | Marine viral communities from the Subarctic Pacific Ocean - 7_ETSP_OMZ_AT15161 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025108 | Marine viral communities from the Subarctic Pacific Ocean - 17_ETSP_OMZ_AT15314 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025109 | Marine viral communities from the Subarctic Pacific Ocean - 6_ETSP_OMZ_AT15160 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025112 | Marine viral communities from the Pacific Ocean - ETNP_2_130 (SPAdes) | Environmental | Open in IMG/M |
| 3300025114 | Marine viral communities from the Subarctic Pacific Ocean - 3_ETSP_OMZ_AT15126 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025118 | Marine viral communities from the Subarctic Pacific Ocean - 10_ETSP_OMZ_AT15264 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025125 | Marine viral communities from the Pacific Ocean - ETNP_2_1000 (SPAdes) | Environmental | Open in IMG/M |
| 3300025128 | Marine viral communities from the Subarctic Pacific Ocean - 4_ETSP_OMZ_AT15127 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025131 | Marine viral communities from the Pacific Ocean - ETNP_6_100 (SPAdes) | Environmental | Open in IMG/M |
| 3300025133 | Marine viral communities from the Subarctic Pacific Ocean - 15_ETSP_OMZ_AT15312 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025141 | Marine viral communities from the Pacific Ocean - ETNP_6_85 (SPAdes) | Environmental | Open in IMG/M |
| 3300025241 | Marine viral communities from the Deep Pacific Ocean - MSP-121 (SPAdes) | Environmental | Open in IMG/M |
| 3300025251 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_906 (SPAdes) | Environmental | Open in IMG/M |
| 3300025264 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_s12 (SPAdes) | Environmental | Open in IMG/M |
| 3300025267 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_Geostar (SPAdes) | Environmental | Open in IMG/M |
| 3300025270 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_904 (SPAdes) | Environmental | Open in IMG/M |
| 3300025274 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_51 (SPAdes) | Environmental | Open in IMG/M |
| 3300025277 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_s16 (SPAdes) | Environmental | Open in IMG/M |
| 3300025280 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_s17 (SPAdes) | Environmental | Open in IMG/M |
| 3300025282 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_M9 (SPAdes) | Environmental | Open in IMG/M |
| 3300025286 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_215 (SPAdes) | Environmental | Open in IMG/M |
| 3300025287 | Marine viral communities from the Deep Pacific Ocean - MSP-131 (SPAdes) | Environmental | Open in IMG/M |
| 3300025293 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_s2 (SPAdes) | Environmental | Open in IMG/M |
| 3300025296 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_231 (SPAdes) | Environmental | Open in IMG/M |
| 3300025300 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_s6 (SPAdes) | Environmental | Open in IMG/M |
| 3300025301 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_908 (SPAdes) | Environmental | Open in IMG/M |
| 3300025305 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_b05 (SPAdes) | Environmental | Open in IMG/M |
| 3300025770 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI072_LV_165m_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025873 | Marine viral communities from the Pacific Ocean - ETNP_6_1000 (SPAdes) | Environmental | Open in IMG/M |
| 3300026202 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201306PF43B (SPAdes) | Environmental | Open in IMG/M |
| 3300027838 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_150 (SPAdes) | Environmental | Open in IMG/M |
| 3300028018 | Seawater viral communities from deep brine pools at the bottom of the Mediterranean Sea - LS1 1600m | Environmental | Open in IMG/M |
| 3300028022 | Seawater viral communities from deep brine pools at the bottom of the Mediterranean Sea - LS1 750m | Environmental | Open in IMG/M |
| 3300028039 | Seawater viral communities from deep brine pools at the bottom of the Mediterranean Sea - LS1 2300m | Environmental | Open in IMG/M |
| 3300031625 | Marine microbial communities from Western Arctic Ocean, Canada - CBN3_surface | Environmental | Open in IMG/M |
| 3300031701 | Marine microbial communities from Western Arctic Ocean, Canada - AG5_Bottom | Environmental | Open in IMG/M |
| 3300031757 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 200m 32315 | Environmental | Open in IMG/M |
| 3300031802 | Marine microbial communities from Western Arctic Ocean, Canada - CB6_AW_1057 | Environmental | Open in IMG/M |
| 3300032006 | Marine microbial communities from station ALOHA, North Pacific Subtropical Gyre - HC15-DNA-20-200_MG | Environmental | Open in IMG/M |
| 3300032146 | Metatranscriptome of marine microbial communities from Western Arctic Ocean, Canada - CBN3_Tmax_316 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300032278 | Marine microbial communities from station ALOHA, North Pacific Subtropical Gyre - HC15-DNA-20-500_MG | Environmental | Open in IMG/M |
| 3300032360 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 500m 34915 | Environmental | Open in IMG/M |
| 3300032820 | Marine microbial communities from station ALOHA, North Pacific Subtropical Gyre - S1503-DNA-20-500_MG | Environmental | Open in IMG/M |
| 3300034628 | Seawater viral communities from Mid-Atlantic Ridge, Atlantic Ocean - 543_2961 | Environmental | Open in IMG/M |
| 3300034629 | Seawater viral communities from Mid-Atlantic Ridge, Atlantic Ocean - 543_2600 | Environmental | Open in IMG/M |
| 3300034654 | Seawater viral communities from Mid-Atlantic Ridge, Atlantic Ocean - 487_2244 | Environmental | Open in IMG/M |
| 3300034656 | Seawater viral communities from Mid-Atlantic Ridge, Atlantic Ocean - 502_2477 | Environmental | Open in IMG/M |
| 3300034658 | Seawater viral communities from Mid-Atlantic Ridge, Atlantic Ocean - 524_CTD | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI25129J35166_10709111 | 3300002484 | Marine | MATYVDRVEKSVTHYEPGPLPSDPESLGLYTVDELKRLGNVLFN |
| JGI25131J35506_10058111 | 3300002511 | Marine | MATYADRVEKSVTRYEPGPLPEQVEDLGGYVVSELKRLGSILLNQSIFR |
| JGI25133J35611_100777861 | 3300002514 | Marine | MATYVDRVEKSVTHYEPGPLPSDPESLGLYTVDELKRLGNV |
| JGI25134J35505_100778322 | 3300002518 | Marine | MVMNSDRVVKSVTHYEPGPLPLDKEDLGLYVVTELKRLGNILFN |
| JGI25134J35505_101288992 | 3300002518 | Marine | MATYVDRVEKSVTHYEPGPLPSDPESLGLYTVDELKRLGNVLF |
| JGI25130J35507_10109823 | 3300002519 | Marine | MATYTDRVEKSVTHYEPGPLPSDPESLGVYTVDELKLRRIHG* |
| JGI25130J35507_10962152 | 3300002519 | Marine | MATFIDRVVKSETRYEPGPLPESVEDLGNYVVTELKRIGNIF |
| JGI25130J35507_11055361 | 3300002519 | Marine | MPTYKDRVVKSVTHYYPNPLPLKEEDLGLYVTNELKRLGDV |
| JGI25136J39404_10059791 | 3300002760 | Marine | MATYSDRVVKSVTHYTPGPLPLDKEDLGIYLINELQRLGDIIYNQAT |
| JGI25136J39404_10178701 | 3300002760 | Marine | MATYKDRVVKSVTHYXPNPLPLDKEDLGLYLTNELKRLGDV |
| JGI25136J39404_10286152 | 3300002760 | Marine | MTTYKDRVVKSVTHYYPNPLPLDQEDLGLYLTNELKRLGDVIFNQATFRL |
| Ga0066847_100950182 | 3300005426 | Marine | MGTYADRVQKSVTLYEPGPLPEEVDDLGLYMVTELKRLGNILYNQAT |
| Ga0066843_101946882 | 3300005551 | Marine | MATHVDRVERSVTHYEPGPLPANPESLGLYLVTELKRLGDILL |
| Ga0066834_101708172 | 3300005596 | Marine | MATYADRVEKSVTRYEPGPLPEQVEDLGGYVVSELKRLGSILLNQSIF |
| Ga0081592_10360793 | 3300006076 | Diffuse Hydrothermal Fluids | MATYVDRVETSVVRYEPGPLPENVEDLGGYVVSELKRLGD |
| Ga0068471_12440982 | 3300006310 | Marine | MATYKDRVVKSVTHYEPGSPPEDPEDMGIYVVNELKRLANVVLN |
| Ga0068471_14326291 | 3300006310 | Marine | MATYTDRVEKSVTHYEPGPLPSDPESLGIYTVDELNRLGNVLFNQAT |
| Ga0068481_14791571 | 3300006339 | Marine | MATYSDRVVKSVTLYEPGPLPEEAEDLGMYVVTELKRLGNTLFNQATF |
| Ga0068503_102512871 | 3300006340 | Marine | MATYSDRVVKSVTLYEPGPLPEEAEDLGMYVVTELKRLGN |
| Ga0068503_102512881 | 3300006340 | Marine | MATYSDRVVKSVTLYEPGPLPEEAEDLGMYVVTELKRLGDILLNQA |
| Ga0068503_103931521 | 3300006340 | Marine | MATYSDRVVKSVTLYEPGPLPEEAEDLGMYVVTELKRLGNTLFNQAT |
| Ga0098070_1056421 | 3300006726 | Marine | MATYADRVVKSVTHYEPGPLPLDKEDLGLYVVNELKRI |
| Ga0098033_10658573 | 3300006736 | Marine | MATYTDRVEKSVTHYEPGPLPSDPESLGLYTVDELKRLGNVLF |
| Ga0098033_10791381 | 3300006736 | Marine | MATYSDRVVKSVIHYTPGPLPLDKEDLGIYLINELQRLGD |
| Ga0098035_11642621 | 3300006738 | Marine | MPTYKDRVVKSVTHYYPNPLPLNEEDLGLYVTNELKRLGDVI |
| Ga0098058_10135841 | 3300006750 | Marine | MATYADRVEKSVTRYEPGPLPEQVDDLGGYVVTELKR |
| Ga0098040_10227722 | 3300006751 | Marine | MAMNPDRVVKSVTHYEPGPLPLDKEDLGLYVVTELKRLGNILFNQA |
| Ga0098040_10351662 | 3300006751 | Marine | MATYKDKVVKSVTHYQPSPLPINQENLGLYLTTELK |
| Ga0098044_12785352 | 3300006754 | Marine | MATYVDRVETSVVRYEPGPLPENVEDLGGYVVSELKRLGDIILNQSSKDR* |
| Ga0098044_13447041 | 3300006754 | Marine | MATYADRVVKSVTHYEPGPLPLDKEDLGLYVVNELKRIGDV |
| Ga0098055_10884982 | 3300006793 | Marine | MATYADRVVKSVTHYEPGPLPLDKEDLGLYVVNELKRIG |
| Ga0098057_10226061 | 3300006926 | Marine | MGTYSDRVVKSVTHYTPGPLPLDKEDLGIYLINELQRL |
| Ga0098034_10677962 | 3300006927 | Marine | MATYKDRVVKSVTHYEPGPLPLDKEDLGIYVVTELKRLADII |
| Ga0098034_10844262 | 3300006927 | Marine | MATYADRVVKSVTHYEPGPLPLDNEDLGLYVVNELKRI |
| Ga0098036_11838221 | 3300006929 | Marine | MATYKDRVVKSVTHYEPGPLPTDDRNLGIYVSTELKRLGDIL |
| Ga0110931_10726462 | 3300007963 | Marine | MATYKDRVVKSVTHYEPGAPPDNSEDMGIYVVNELKRLQT* |
| Ga0110931_11045381 | 3300007963 | Marine | MATYKDRVVKSVTYYEPGPLPLDQEDLGIYVVTELKRLGN |
| Ga0110931_12132881 | 3300007963 | Marine | MATFADRVEKSLTRYEPGPLPEQVEDLGGYVVSELKRLG |
| Ga0110931_12535271 | 3300007963 | Marine | MATYVDRVETSVVRYEPGPLPETVEDLGGYVVSELKRLGDIILNQSLVRID |
| Ga0098052_13095352 | 3300008050 | Marine | MATYADRVVKSVTHYEPGPLPADQESLGLYIVNELKRLGDVLLN |
| Ga0098062_10630772 | 3300008051 | Marine | MATYADRVEKSVTRYEPGPLPEQVDDLGGYVVTELKRLGDILLNQSIF |
| Ga0114898_10810981 | 3300008216 | Deep Ocean | MATYTDRVEKSVTHYEPGPLPSDPESLGVYTVEELKRLGN |
| Ga0114899_10537621 | 3300008217 | Deep Ocean | MATYTDRVEKSVTHYEPGPVPSDPESLGVYTVDEL |
| Ga0114899_11617021 | 3300008217 | Deep Ocean | VGYAVVATNVDRVERSVTHYEPGPLPADPESLGLYLVTELKRLGDI |
| Ga0114899_11947183 | 3300008217 | Deep Ocean | MATHVDRVERSVTHYEPGPLPADTESLGLYLVTELKRLGDILLNQ |
| Ga0114899_12574001 | 3300008217 | Deep Ocean | MATNVDRVERSVTHYEPGPLPLSQEDLGQYVVNELKR |
| Ga0114904_10065727 | 3300008218 | Deep Ocean | MATNVDRVERSVTHYEPGPLPADTESLGLYLVTELKRLGDILLN |
| Ga0114904_10788481 | 3300008218 | Deep Ocean | MATNVDRVERSVTHYEPGPLPSDTESLGLYTVEELKRLGN |
| Ga0114904_10933631 | 3300008218 | Deep Ocean | MATYKDRVVKSVTHYEPGSPPDNPEDMGIYVVNELKRLANVVLNQAI |
| Ga0114905_10929631 | 3300008219 | Deep Ocean | MPTYSDRVVKSVTHYQPGPLPLNNEDLGVYVVDELKRLGNIL |
| Ga0114905_11094472 | 3300008219 | Deep Ocean | MATYKDRVVKSVTHYEPGAPPDNPEDMGIYVVNELK |
| Ga0114905_11354332 | 3300008219 | Deep Ocean | MATYKDRVVKSVTHYEPGAPPVNQEDMGIYVVTELKRLANV |
| Ga0114905_12217502 | 3300008219 | Deep Ocean | MATYSDRVVKSVTHYQPGPLPLNNEDLGVYVVDELK |
| Ga0114910_10326742 | 3300008220 | Deep Ocean | MATYTDRVEKSVTHYEPGPLPSDPESLGIYIISELKR |
| Ga0114910_11039331 | 3300008220 | Deep Ocean | MATHPDRVERSVTHYEPGPLPADTESLGLYIITELKRL |
| Ga0114910_11346463 | 3300008220 | Deep Ocean | MATYTDRVEKSVTHYEPGPLPSDTESLGLYTVEELKRLGNVLLNQATF |
| Ga0114910_11837762 | 3300008220 | Deep Ocean | MATHVDRVERSVTHYEPGPLPADPESLGLYLVTELKRLGD |
| Ga0114903_10337353 | 3300009412 | Deep Ocean | MATYTDRVEKSVTHYEPGPLPSDPESLGVYTVEELKRLGNVLF |
| Ga0114903_11240131 | 3300009412 | Deep Ocean | MATNVDRVERSVSHYEPGPLPADPESLGLYLVTELKR |
| Ga0114903_11476782 | 3300009412 | Deep Ocean | MATYTDRVEKSVTHYEPGPLPSDTESLGLYTVEELKRLGNVLLN |
| Ga0114909_10203702 | 3300009414 | Deep Ocean | MATYVDRVETSVVRYEPGPLPENVEDLGGYVVSELKRIGDIILNQSLVRIDR |
| Ga0114908_11422321 | 3300009418 | Deep Ocean | VGYAVVATNVDRVERSVTHYEPGPLPADPESLGLYLVTELKRLGDILLNQ |
| Ga0114908_11701682 | 3300009418 | Deep Ocean | MATNPDRVVKSVTHYAPELPPDNPNDLPVYVVTELKRLADILLNQA |
| Ga0114908_12351312 | 3300009418 | Deep Ocean | MATYEDRVEKSVVRYEPGPLPEEVEDLGGYVVTELKRLGNI |
| Ga0114932_105122192 | 3300009481 | Deep Subsurface | MATYSDRVVKSVTHYQPGPLPLDNEDLGIYVVAELKRLGNILFN |
| Ga0114932_107412092 | 3300009481 | Deep Subsurface | MATYTDRVVKSVTHYAPNPLPINQEDLGVYLINEL |
| Ga0105214_1062471 | 3300009595 | Marine Oceanic | MATHVDRVERSVTHYDPGPLLLSEEDLGKYMVHELKRLGDIL* |
| Ga0114900_10615722 | 3300009602 | Deep Ocean | MATHVDRVERSVTHYQPNPLPVNEQDLGLYITNELKRLGDILF |
| Ga0114911_11422232 | 3300009603 | Deep Ocean | VATYSDRVVKSVTLYEPGPLPEEAEDIGMYVVTELKRLGN |
| Ga0114911_12152471 | 3300009603 | Deep Ocean | MATYTDRVEKSVTHYEPGPLPSDTESLGLYTVEELKRLGNVL |
| Ga0114901_11822771 | 3300009604 | Deep Ocean | MATYTDRVVKSVTHYEPGPPPSDPESLGIYIVSELKRLGDIL |
| Ga0114906_10812631 | 3300009605 | Deep Ocean | MATYTDRVAKSVTHYEPGPLPADQESLGLYIVNELK |
| Ga0114906_11062263 | 3300009605 | Deep Ocean | MATYKDRVVKSVTHYEPGSPPDDPEDMGIYVVNELKRLANVVLNQA |
| Ga0105236_10128271 | 3300009619 | Marine Oceanic | MATYKDRVVKSVTHYQPGPLPLDNEDLGIYVIDELK |
| Ga0114912_11556951 | 3300009620 | Deep Ocean | MATYTDRVEKSVTHYEPGPLPSDTESLGLYTVEELKRLGNVLLNQAT |
| Ga0105235_1151371 | 3300009791 | Marine Oceanic | MATNVDRVERSVTHYEPGPLPADSESLGLYLVTELKR |
| Ga0098056_11906971 | 3300010150 | Marine | MGTYADRVVKSVTHYEPGPLPLDKENLGLYVVNELKRIGDVFFNQAT |
| Ga0098061_11353362 | 3300010151 | Marine | MATYADRVVKSVTHYEPGPLPTDSEDLGIYVVTELK |
| Ga0098047_100220964 | 3300010155 | Marine | MATHVDRVERSVTHYSPGPLPVNPEDLGQYVVTELKRLGDI |
| Ga0098047_100689401 | 3300010155 | Marine | MATYADRVVKSVTHYEPGPLPLDKEGLGLYVVNELKRI |
| Ga0098047_103010082 | 3300010155 | Marine | MATYTDRVEKSVTHYEPGPLPSDPESLGLYTVDELKRLGNVLFNQA |
| Ga0181432_10888591 | 3300017775 | Seawater | MATYTDRVEKSVTHYEPGPLPSDPESLGVYTVDELKR |
| Ga0181432_13031742 | 3300017775 | Seawater | MATFIDRVVKSETRYEPGPLPENVEDLGNYVVTELKRIGSIFL |
| Ga0211646_102971671 | 3300020383 | Marine | MATFIDRVVKSETRYEPGPLPEQVEDLGNYVVTELKRIGNIFLNQATFRL |
| Ga0211549_100600581 | 3300020425 | Marine | MATYKDRVVKSVRYYEPGPLPLDDKDLGVYIVTELKRLGNT |
| Ga0226832_101524552 | 3300021791 | Hydrothermal Vent Fluids | MATFIDRVVKSETRYEPGPLPESVEDLGNYLVTELKRIGNIFF |
| Ga0226832_101643751 | 3300021791 | Hydrothermal Vent Fluids | MATYKDRVVKSVTYYEPGPLPLEQEDLGIYVVTELKRLGNTILN |
| Ga0232641_11396803 | 3300021979 | Hydrothermal Vent Fluids | MATYTDRVEKSVTHYEPGPVPSDPETLGIYVVEELKRLG |
| Ga0257021_10766631 | 3300023500 | Marine | MATHVDRVERSVTHYEPGPPPIDPEDLGQYVVDELKRLG |
| (restricted) Ga0255049_101995231 | 3300024517 | Seawater | MATYKDRVVKSVTHYEPGPLPLDQEDLGIYVVTELK |
| (restricted) Ga0255048_101798301 | 3300024518 | Seawater | MATFIDRVVKSETRYEPGPLPESVEDLGNYLVTELKRIGNIFLNQATFRLE |
| (restricted) Ga0255048_102419252 | 3300024518 | Seawater | MATYADRVVKSVTHYQPSPLPINQEDLGLYLTTELKRLGDIL |
| Ga0207889_10134662 | 3300025042 | Marine | MGTYADRVVKSVTHYEPGPLPLDKEDLGLYVVNELKRIGDVFFN |
| Ga0207889_10204001 | 3300025042 | Marine | MATYADRVVKSVTHYEPGPLPLDKEDLGLYVVNELKRIGDVFFNQA |
| Ga0207907_1282242 | 3300025043 | Marine | MATYKDRVVKSVTHYYPNPLPLNEEDLGLYITNELKRLGDV |
| Ga0207891_10236321 | 3300025044 | Marine | MATYSDRVVKSVTHYQPGPLPLDKEDIGLYVVDEL |
| Ga0207901_10101561 | 3300025045 | Marine | MATYSDRVVKSVTHYQPGPLPLDNEDLGVYVVDELKRLGNI |
| Ga0207902_10367692 | 3300025046 | Marine | MATYSDRVVKSVTLYEPGPLPEEVEDLGMYVVTELKRLG |
| Ga0207892_10271561 | 3300025050 | Marine | MATYSDRVVKSVTLYEPGPLPEEVEDLGMYVVTELKRLGDTLFNQAT |
| Ga0207906_10126722 | 3300025052 | Marine | MATYSDRVVKSVTHYQPNPLPLNQEDLGLYITTELKRLGDVI |
| Ga0207906_10550642 | 3300025052 | Marine | MATYKDRVVKSVTHYEPGPLPLDKEDLGIYVVTELKRLADI |
| Ga0207887_10578272 | 3300025069 | Marine | MATYADRVVKSVTHYEPGPLPLDSEDLGLYVVNELKRI |
| Ga0207887_10585362 | 3300025069 | Marine | MATYADRVEKSVTRYEPGPLPEEVEDLGGYVVSELKRL |
| Ga0208011_10223242 | 3300025096 | Marine | MATYKDKVVKSVTHYQPSPLPINQENLGLYLTTELKR |
| Ga0208011_10363862 | 3300025096 | Marine | MATYADRVEKSVTRYEPGPLPEQVDDLGGYVVTELK |
| Ga0208793_11738242 | 3300025108 | Marine | MATYADRVEKSVTRYEPGPLPEQVDDLGGYVVTELKRLG |
| Ga0208553_10976661 | 3300025109 | Marine | MATYSDRVVKSVIHYTPGPLPLDKEDLGIYLINELQRL |
| Ga0209349_10359772 | 3300025112 | Marine | MATHVDRVERSVTHYSPGPLPVNPEDLGQYVVTELKRLGDIL |
| Ga0209349_11379832 | 3300025112 | Marine | MATYVDRVEKSVTHYEPGPLPSDPESLGLYTVDELKRLGNVLFNQATFR |
| Ga0208433_10358952 | 3300025114 | Marine | MATYADRVEKSVTRYEPGPLPEQVDDLGGYVVTELKRLGDILLNQSMFRL |
| Ga0208790_10543021 | 3300025118 | Marine | MATYKDRVVKSVTHYEPGPLPLDKEDLGIYVVTELKRLADIIFNQA |
| Ga0209644_10660441 | 3300025125 | Marine | MATYSDRVVKSVTLYEPGPLPEEVEDLGMYVVTELKRL |
| Ga0209644_10974822 | 3300025125 | Marine | MATYVDRVETSVVRYEPGPLPETVDDLGGYVVSELKRLGDIILNQSLVRI |
| Ga0209644_10989521 | 3300025125 | Marine | MATYSDRVVKSVTHYQPNPLPIDQEDLGLYLTTELKRLGDV |
| Ga0208919_11072401 | 3300025128 | Marine | MATYADRVEKSVTRYEPGPLPEQVDDLGGYVVTELKRLGDILLNQSIFR |
| Ga0208919_12325092 | 3300025128 | Marine | MATYKDRVVKSVTYYEPGPLPLDQEDLGIYVVTELKRL |
| Ga0209128_10927413 | 3300025131 | Marine | MATYKDRVVKSVTHYEPGPLPLDKEDLGIYVVTEL |
| Ga0208299_11644481 | 3300025133 | Marine | MATYTDRVVKSVTHYEPGPLPTDSEDLGVYVVTELKRLGDVLF |
| Ga0208299_11865172 | 3300025133 | Marine | MATYADRVEKSVTRYEPGPLPEQVDDLGGYVVTELKRLGD |
| Ga0209756_11239821 | 3300025141 | Marine | MATHVDRVERSVTHYSPGPLPVNPEDLGQYVVTELKRLG |
| Ga0207893_10441372 | 3300025241 | Deep Ocean | MATYVDRVETSVVRYEPGPLPENVEDLGGYVVSELKRLGDIILNQ |
| Ga0208182_10308013 | 3300025251 | Deep Ocean | MATNVDRVERSVTHYEPGPLPADPESLGLYLVTELKRLGDIL |
| Ga0208029_10133691 | 3300025264 | Deep Ocean | MATYADRVEKSVTRYEPGPLPEQVDDLGGYVVTELKRLGDILLNQSIFRLE |
| Ga0208179_10247952 | 3300025267 | Deep Ocean | MATYTDRVEKSVTHYEPGPLPSDTESLGLYTVEELKR |
| Ga0208813_10827751 | 3300025270 | Deep Ocean | MATYSDRVVKSVTHYQPGPLPLNNEDLGVYVVDELKRLGNILFN |
| Ga0208183_10960673 | 3300025274 | Deep Ocean | MATNVDRVERSVTHYEPGPLPADPESLGLYLVTELKRLGDILLN |
| Ga0208180_10733021 | 3300025277 | Deep Ocean | MATYKDRVVKSVRYYEPGPLPLDQEDLGVYVVTELKRLANTIL |
| Ga0208180_10872551 | 3300025277 | Deep Ocean | MATYTDRVEKSVTHYEPGPLPSDTESLGLYTVEELKRLGNV |
| Ga0208180_11235491 | 3300025277 | Deep Ocean | MATNVDRVERSVTHYEPGPLPADPESLGLYLVTELKRLGD |
| Ga0208449_10275391 | 3300025280 | Deep Ocean | MATYTDRVEKSVTHYEPGPLPSDPESLGVYTVEELKRLGNVL |
| Ga0208449_10838082 | 3300025280 | Deep Ocean | MATNVDRVERSVTHYEPGPLPADPESLGLYLVTELKRLGDILLNQATFR |
| Ga0208449_10910171 | 3300025280 | Deep Ocean | MATNVDRVERSVTHYEPGPLPADPESLGLYLVTELKRLG |
| Ga0208030_10061771 | 3300025282 | Deep Ocean | MATYKDRVVKSVTHYEPGSPPDDPEDMGIYVVNELKRLANVVLN |
| Ga0208030_11613042 | 3300025282 | Deep Ocean | MATYTDRVEKSVTHYEPGPLPSDPESLGIYIISELKRLGDILLN |
| Ga0208315_10034551 | 3300025286 | Deep Ocean | MATYKDRVVKSVTHYEPGPLPLEQEDLGLYVVTELKRL |
| Ga0208315_10575491 | 3300025286 | Deep Ocean | MATYVDRVETSVVRYEPGPLPENVEDLGGYVVSELKRLGDII |
| Ga0208315_10655641 | 3300025286 | Deep Ocean | MATNVDRVERSVTHYEPGPLPADPESLGLYLVTELKRLGDILL |
| Ga0208315_10912461 | 3300025286 | Deep Ocean | MATYTDRVEKSVTHYEPGPLPSDTESLGLYTVEELKRLGNVLLNQ |
| Ga0208315_11032841 | 3300025286 | Deep Ocean | MATYTDRVEKSVTHYEPGPLPSDPESLGVYTVEELKRL |
| Ga0208315_11063932 | 3300025286 | Deep Ocean | MATYKDRVVKSVTHYQPGPLPLGEEDLGVYVTDELKRLGNIIFNQATF |
| Ga0207903_10846361 | 3300025287 | Deep Ocean | VATYIDRVEKSVTHYEPGPLPEEVEDLGGYVVSELKRLGDIILNQAI |
| Ga0208934_10466813 | 3300025293 | Deep Ocean | MATNVDRVERSVTHYEPGPLPADPESLGLYLVTELK |
| Ga0208316_10543371 | 3300025296 | Deep Ocean | MATYKDRVVKSVTHYQPNPLPVNEQDLGLYITNELK |
| Ga0208316_10624402 | 3300025296 | Deep Ocean | MATYKDRVVKSVRYYEPGPLPLDQEDLGVYVVTELKRLANTI |
| Ga0208316_10847472 | 3300025296 | Deep Ocean | MAMFSARVVKSETRYEPGPLPENVEDLGGYLVTELKRLGGILFN |
| Ga0208181_10392813 | 3300025300 | Deep Ocean | MATYKDRVVKSVTHYEPGSPPDDPEDMGIYVVNELKRLANVVLNQAIFRLE |
| Ga0208450_10201271 | 3300025301 | Deep Ocean | MATYVDRVETSVVRYEPGPLPENVEDLGGYVVSELKRLGDIILN |
| Ga0208450_10598403 | 3300025301 | Deep Ocean | MATNVDRVERSVTHYEPGPLPADPESLGLYLVTELKRLGDI |
| Ga0208684_10105071 | 3300025305 | Deep Ocean | MATHPDRVERSVTHYEPGPLPINTEDIGQYLITELK |
| Ga0208684_10282042 | 3300025305 | Deep Ocean | MATYTDRVEKSVTHYEPGPLPSDPESLGIYIISELKRLG |
| Ga0208684_10350233 | 3300025305 | Deep Ocean | MATYKDRVVKSVTHYEPGSPPDNPEDMGIYVVNELKRLANVVLN |
| Ga0208684_11178112 | 3300025305 | Deep Ocean | MATYTDRVEKSVTHYEPGPLPSDTESLGLYTVEELKRLGNVLLNQATFR |
| Ga0209362_12532731 | 3300025770 | Marine | MATYSDRVQKSVTLYEPGPLPEDTDDLGLYLVTELKRLGSILYN |
| Ga0209757_100266082 | 3300025873 | Marine | MATYKDRVVKSVRYYEPGPLPPEEKDLGVYVVTELKRLGNTILNQSHL |
| Ga0209757_100926851 | 3300025873 | Marine | MATYKDRVVKSVTYYEPGPLPLDNEDLGIYVVTELKRLGNTI |
| Ga0209757_101211602 | 3300025873 | Marine | MATYSDRVVKSVTLYEPGPLPEEAEDLGMYVVTELKRL |
| Ga0209757_101365612 | 3300025873 | Marine | MATYKDRVVKSVTYYEPGPLPLDQEDLGLYVVTELKRLGNTI |
| Ga0209757_101532932 | 3300025873 | Marine | MATYSDRVVKSVTLYEPGPLPEEVEDLGMYVVTEL |
| Ga0209757_103090772 | 3300025873 | Marine | MATYKDRVVKSVTHYEPGPLPLEEKDLGIYVVTELKRLADIV |
| Ga0207984_10267101 | 3300026202 | Marine | MATYVDRVEKSVTHYEPGPLPSDPESLGLYTVDELKRLGNVL |
| Ga0209089_106927651 | 3300027838 | Marine | MGTYTDRVVKSVTHYTPGPLPLNQEDLGVYIISELR |
| Ga0256381_10362472 | 3300028018 | Seawater | MATNVDRVERSVTHYEPGPLPADPESLGLYLVTELKRLGDP |
| Ga0256382_10984591 | 3300028022 | Seawater | MATYSDRVVKSVTLYEPGPLPEEVEDLGMYIVTELKRLGNTMFNQ |
| Ga0256382_11065232 | 3300028022 | Seawater | MGTYSDRVVKSVTHYTPGPLPLDKEDLGIYLINELQRLGDIIY |
| Ga0256380_10571842 | 3300028039 | Seawater | MATYKDRVVKSVRYYEPGPLPLENEDLGIYVVTELKRLANTILNQ |
| Ga0302135_104238181 | 3300031625 | Marine | MATFIDRVVKSETRYEPGPLPEDVADIGNYLVTEL |
| Ga0302120_102319891 | 3300031701 | Marine | MATFIDRVVKSETRYEPGPLPEGVEDLGNYVVTELKRIGS |
| Ga0315328_102003872 | 3300031757 | Seawater | MATYKDKVVKSVTHYQPSTLPINQDDLGLYLTTELKRLGDI |
| Ga0310123_108903732 | 3300031802 | Marine | MATHVDRVERSVTHYEPGPLPVNPEDLGIYVVNELKRLGD |
| Ga0310344_101786171 | 3300032006 | Seawater | MATYTDRVQKSVTLYEPGPIPEEQEDLATYLVTELKR |
| Ga0315303_10755451 | 3300032146 | Marine | MATFIDRVVKSETRYEPGPLPEGVEDLGNYVVTELKRIGSIFL |
| Ga0315303_11319572 | 3300032146 | Marine | MATYKDRVVKSVTHYQPGPLPLDNEDLGVYIVDELKRLGNILFN |
| Ga0310345_105208631 | 3300032278 | Seawater | VATYADRVEKSVTRYEPGPLPEQVEDLGGYVVSELKRLGSILLNQSIFR |
| Ga0310345_111322681 | 3300032278 | Seawater | MATYKDRVVKSVTYYEPGPLPLEQEDLGVYIVTELKRLGNTILNQ |
| Ga0315334_115500922 | 3300032360 | Seawater | MATYSDRVVKSVTHYQPNPLPIDQEDLGLYLTTEL |
| Ga0310342_1001357414 | 3300032820 | Seawater | MATYKDRVVKSVTYYEPGPLPLDNEDLGIYVVTEL |
| Ga0310342_1008515611 | 3300032820 | Seawater | MATFIDRVVKSETRYEPGPLPEQVEDLGNYVVTELKRIGSIFLNQATF |
| Ga0310342_1013478711 | 3300032820 | Seawater | MATYSDRVVKSVTLYEPGPLPEEAEDLGMYVVTELKR |
| Ga0326755_017110_574_702 | 3300034628 | Filtered Seawater | MATFIDRVVKSETRYEPGPLPESVEDLGNYVVTELKRIGSIFL |
| Ga0326756_004639_3_122 | 3300034629 | Filtered Seawater | MATYKDRVVKSVRYYEPGPLPLEEKDLGVYIVTELKRLGN |
| Ga0326756_036126_487_600 | 3300034629 | Filtered Seawater | MATYKDRVVKSVTHYEPGSPPDNPEDMGIYVVNELKRL |
| Ga0326741_024161_1_138 | 3300034654 | Filtered Seawater | MATYKDRVVKSVTYYEPGPLPLEQEDLGLYVVTELKRLANTILNQA |
| Ga0326741_034426_2_118 | 3300034654 | Filtered Seawater | MATYSDRVVKSVTHYQPGPLPLDNEDLGVYVVDELKRLG |
| Ga0326741_085437_381_518 | 3300034654 | Filtered Seawater | MATYEDRVEKSVTHYEPGPLPEEVEDLGGYVVTELKRLGDIILNQA |
| Ga0326748_017395_1_144 | 3300034656 | Filtered Seawater | MATFIDRVVKSETRYEPGPLPESVEDLGNYLVTELKRIGSIFFNQVPL |
| Ga0326751_026213_444_578 | 3300034658 | Filtered Seawater | MATYSDRVVKSVTLYEPGPLPEEVEDLGMYIVTELKRLGNTLFNQ |
| ⦗Top⦘ |