NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0326721_10865470

Scaffold Ga0326721_10865470


Overview

Basic Information
Taxon OID3300032080 Open in IMG/M
Scaffold IDGa0326721_10865470 Open in IMG/M
Source Dataset NameSoil microbial communities from Southern Great Plains, Lamont, Oklahoma, United States - SGP_1_2016
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)570
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil → Soil And Marine Airborne Microbial Communities From Various Locations

Source Dataset Sampling Location
Location NameUSA: Oklahoma
CoordinatesLat. (o)36.36Long. (o)-97.29Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F100611Metagenome / Metatranscriptome102Y

Sequences

Protein IDFamilyRBSSequence
Ga0326721_108654702F100611GGAGMEAVRCTQCGGTRWSLLGSLTHLLEEPCELCGGPRTIERRRPGAGPETLDIERRRAEIADRIAGRHADDRLTTR

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.