NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0315294_11353996

Scaffold Ga0315294_11353996


Overview

Basic Information
Taxon OID3300031952 Open in IMG/M
Scaffold IDGa0315294_11353996 Open in IMG/M
Source Dataset NameSediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G13_40
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)566
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families3

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment → Extremophilic Microbial Mat Communities From Usa And Mexico

Source Dataset Sampling Location
Location NameUSA: Wyoming
CoordinatesLat. (o)44.5395Long. (o)-110.3891Alt. (m)Depth (m)61
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F009147Metagenome / Metatranscriptome322N
F038227Metagenome / Metatranscriptome166N
F051790Metagenome / Metatranscriptome143Y

Sequences

Protein IDFamilyRBSSequence
Ga0315294_113539961F009147N/AEGFALVTSTAAQTGNWSGLIPTEPTVFTSITGYQISGTWTSKTIPAGLPLVGNITGFQISSGSVVAFLARS
Ga0315294_113539962F038227N/AMISIGIALNRLFAGQAGGTDAPVLRRDVLQEDDFFVLQEDGSGKLVITFGTFDSLLREDAGFLQQEDAFKLAIQSN
Ga0315294_113539963F051790N/AMADSKITALTALTAADPVNDMFPVVDVSDTSMAASGTTK
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.