| Basic Information | |
|---|---|
| Family ID | F051790 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 143 |
| Average Sequence Length | 43 residues |
| Representative Sequence | MADTKITALTALTAADPANDVIPIVDVSDTSMAASGTTKK |
| Number of Associated Samples | 121 |
| Number of Associated Scaffolds | 143 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 6.52 % |
| % of genes near scaffold ends (potentially truncated) | 96.50 % |
| % of genes from short scaffolds (< 2000 bps) | 89.51 % |
| Associated GOLD sequencing projects | 114 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.21 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (72.727 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater (11.189 % of family members) |
| Environment Ontology (ENVO) | Unclassified (39.860 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (43.357 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 14.71% β-sheet: 0.00% Coil/Unstructured: 85.29% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.21 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 143 Family Scaffolds |
|---|---|---|
| PF05136 | Phage_portal_2 | 0.70 |
| PF12904 | Collagen_bind_2 | 0.70 |
| PF00574 | CLP_protease | 0.70 |
| PF03237 | Terminase_6N | 0.70 |
| COG ID | Name | Functional Category | % Frequency in 143 Family Scaffolds |
|---|---|---|---|
| COG0616 | Periplasmic serine protease, ClpP class | Posttranslational modification, protein turnover, chaperones [O] | 1.40 |
| COG0740 | ATP-dependent protease ClpP, protease subunit | Posttranslational modification, protein turnover, chaperones [O] | 1.40 |
| COG1030 | Membrane-bound serine protease NfeD, ClpP class | Posttranslational modification, protein turnover, chaperones [O] | 0.70 |
| COG5511 | Phage capsid protein | Mobilome: prophages, transposons [X] | 0.70 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 72.73 % |
| All Organisms | root | All Organisms | 27.27 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300002201|metazooDRAFT_1271523 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 784 | Open in IMG/M |
| 3300002408|B570J29032_109060909 | Not Available | 581 | Open in IMG/M |
| 3300002408|B570J29032_109678714 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1041 | Open in IMG/M |
| 3300002835|B570J40625_100291024 | Not Available | 1664 | Open in IMG/M |
| 3300002835|B570J40625_101595299 | Not Available | 533 | Open in IMG/M |
| 3300005527|Ga0068876_10257228 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1000 | Open in IMG/M |
| 3300005528|Ga0068872_10390450 | Not Available | 758 | Open in IMG/M |
| 3300005581|Ga0049081_10168745 | Not Available | 795 | Open in IMG/M |
| 3300005584|Ga0049082_10043738 | Not Available | 1567 | Open in IMG/M |
| 3300005662|Ga0078894_11684251 | Not Available | 521 | Open in IMG/M |
| 3300005805|Ga0079957_1079390 | Not Available | 1861 | Open in IMG/M |
| 3300005943|Ga0073926_10014282 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1426 | Open in IMG/M |
| 3300006802|Ga0070749_10255565 | Not Available | 991 | Open in IMG/M |
| 3300006802|Ga0070749_10477107 | Not Available | 681 | Open in IMG/M |
| 3300006802|Ga0070749_10520428 | Not Available | 646 | Open in IMG/M |
| 3300006802|Ga0070749_10524963 | Not Available | 643 | Open in IMG/M |
| 3300006802|Ga0070749_10705788 | Not Available | 539 | Open in IMG/M |
| 3300006875|Ga0075473_10001509 | All Organisms → cellular organisms → Bacteria | 9689 | Open in IMG/M |
| 3300006875|Ga0075473_10058311 | Not Available | 1500 | Open in IMG/M |
| 3300006916|Ga0070750_10478004 | Not Available | 513 | Open in IMG/M |
| 3300007363|Ga0075458_10234238 | Not Available | 560 | Open in IMG/M |
| 3300007544|Ga0102861_1232224 | Not Available | 510 | Open in IMG/M |
| 3300007548|Ga0102877_1070579 | Not Available | 1001 | Open in IMG/M |
| 3300007560|Ga0102913_1210738 | Not Available | 623 | Open in IMG/M |
| 3300007585|Ga0102916_1229663 | Not Available | 506 | Open in IMG/M |
| 3300007618|Ga0102896_1237478 | Not Available | 568 | Open in IMG/M |
| 3300007622|Ga0102863_1043361 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1307 | Open in IMG/M |
| 3300007639|Ga0102865_1135745 | Not Available | 736 | Open in IMG/M |
| 3300007642|Ga0102876_1153477 | Not Available | 616 | Open in IMG/M |
| 3300007864|Ga0105749_1096769 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 648 | Open in IMG/M |
| 3300007972|Ga0105745_1130029 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 760 | Open in IMG/M |
| 3300007973|Ga0105746_1099503 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 954 | Open in IMG/M |
| 3300007974|Ga0105747_1262511 | Not Available | 579 | Open in IMG/M |
| 3300007974|Ga0105747_1333471 | Not Available | 517 | Open in IMG/M |
| 3300007992|Ga0105748_10153214 | Not Available | 945 | Open in IMG/M |
| 3300007992|Ga0105748_10463725 | Not Available | 551 | Open in IMG/M |
| 3300008117|Ga0114351_1047614 | Not Available | 2696 | Open in IMG/M |
| 3300008264|Ga0114353_1377802 | Not Available | 535 | Open in IMG/M |
| 3300008266|Ga0114363_1090573 | Not Available | 1119 | Open in IMG/M |
| 3300008450|Ga0114880_1151333 | Not Available | 835 | Open in IMG/M |
| 3300008450|Ga0114880_1274580 | Not Available | 508 | Open in IMG/M |
| 3300009039|Ga0105152_10140008 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 989 | Open in IMG/M |
| 3300009081|Ga0105098_10061493 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1551 | Open in IMG/M |
| 3300009146|Ga0105091_10335563 | Not Available | 743 | Open in IMG/M |
| 3300009158|Ga0114977_10434853 | Not Available | 726 | Open in IMG/M |
| 3300009159|Ga0114978_10630306 | Not Available | 617 | Open in IMG/M |
| 3300009183|Ga0114974_10551479 | Not Available | 641 | Open in IMG/M |
| 3300010354|Ga0129333_10469543 | Not Available | 1106 | Open in IMG/M |
| 3300010392|Ga0118731_109619565 | Not Available | 1116 | Open in IMG/M |
| 3300010885|Ga0133913_11220088 | Not Available | 1927 | Open in IMG/M |
| 3300011116|Ga0151516_10746 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 14946 | Open in IMG/M |
| 3300012012|Ga0153799_1053746 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium | 738 | Open in IMG/M |
| 3300012017|Ga0153801_1042820 | Not Available | 799 | Open in IMG/M |
| 3300012708|Ga0157595_1032785 | All Organisms → Viruses → Predicted Viral | 1522 | Open in IMG/M |
| 3300012769|Ga0138279_1212673 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 574 | Open in IMG/M |
| 3300013004|Ga0164293_10832658 | Not Available | 583 | Open in IMG/M |
| 3300013005|Ga0164292_10599705 | Not Available | 711 | Open in IMG/M |
| (restricted) 3300013126|Ga0172367_10239222 | All Organisms → Viruses → Predicted Viral | 1111 | Open in IMG/M |
| 3300013372|Ga0177922_10119568 | Not Available | 867 | Open in IMG/M |
| 3300014208|Ga0172379_10050170 | Not Available | 3672 | Open in IMG/M |
| 3300014801|Ga0119946_1012668 | Not Available | 875 | Open in IMG/M |
| 3300017701|Ga0181364_1060234 | Not Available | 587 | Open in IMG/M |
| 3300017747|Ga0181352_1046596 | Not Available | 1270 | Open in IMG/M |
| 3300017747|Ga0181352_1081286 | Not Available | 905 | Open in IMG/M |
| 3300017747|Ga0181352_1095015 | Not Available | 822 | Open in IMG/M |
| 3300017774|Ga0181358_1086783 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1136 | Open in IMG/M |
| 3300017785|Ga0181355_1051836 | Not Available | 1742 | Open in IMG/M |
| 3300017785|Ga0181355_1204746 | Not Available | 774 | Open in IMG/M |
| 3300018067|Ga0184611_1181285 | Not Available | 749 | Open in IMG/M |
| 3300019784|Ga0181359_1105307 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1028 | Open in IMG/M |
| 3300020161|Ga0211726_10888259 | Not Available | 1150 | Open in IMG/M |
| 3300020204|Ga0194116_10267355 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 922 | Open in IMG/M |
| 3300020549|Ga0207942_1022614 | Not Available | 800 | Open in IMG/M |
| 3300020550|Ga0208600_1026967 | Not Available | 906 | Open in IMG/M |
| 3300020555|Ga0208358_1025494 | Not Available | 967 | Open in IMG/M |
| 3300021141|Ga0214163_1078245 | Not Available | 798 | Open in IMG/M |
| 3300021963|Ga0222712_10371741 | Not Available | 876 | Open in IMG/M |
| 3300022748|Ga0228702_1138830 | Not Available | 537 | Open in IMG/M |
| 3300024346|Ga0244775_11236778 | Not Available | 580 | Open in IMG/M |
| 3300025585|Ga0208546_1123534 | Not Available | 566 | Open in IMG/M |
| 3300025732|Ga0208784_1096511 | Not Available | 886 | Open in IMG/M |
| 3300025818|Ga0208542_1151657 | Not Available | 630 | Open in IMG/M |
| 3300025843|Ga0209182_10065395 | All Organisms → Viruses → Predicted Viral | 1040 | Open in IMG/M |
| 3300025848|Ga0208005_1174929 | Not Available | 668 | Open in IMG/M |
| 3300027138|Ga0255064_1039054 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 769 | Open in IMG/M |
| 3300027141|Ga0255076_1038490 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 844 | Open in IMG/M |
| 3300027148|Ga0255115_1072562 | Not Available | 605 | Open in IMG/M |
| 3300027153|Ga0255083_1015518 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1663 | Open in IMG/M |
| 3300027156|Ga0255078_1007611 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2591 | Open in IMG/M |
| 3300027205|Ga0208926_1004012 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2150 | Open in IMG/M |
| 3300027210|Ga0208802_1002153 | All Organisms → Viruses → Predicted Viral | 2743 | Open in IMG/M |
| 3300027214|Ga0208306_1010712 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1745 | Open in IMG/M |
| 3300027224|Ga0208164_1016698 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1379 | Open in IMG/M |
| 3300027224|Ga0208164_1088037 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 526 | Open in IMG/M |
| 3300027594|Ga0255120_1026638 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1154 | Open in IMG/M |
| 3300027659|Ga0208975_1044746 | Not Available | 1375 | Open in IMG/M |
| 3300027732|Ga0209442_1181932 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 789 | Open in IMG/M |
| 3300027782|Ga0209500_10310320 | Not Available | 664 | Open in IMG/M |
| 3300027785|Ga0209246_10262131 | Not Available | 668 | Open in IMG/M |
| 3300027808|Ga0209354_10349178 | Not Available | 582 | Open in IMG/M |
| 3300027971|Ga0209401_1089666 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1290 | Open in IMG/M |
| 3300027972|Ga0209079_10153100 | Not Available | 790 | Open in IMG/M |
| 3300028298|Ga0268280_1185440 | All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetes bacterium GWB1_59_5 | 532 | Open in IMG/M |
| 3300031539|Ga0307380_10081821 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → Phycisphaerales → Phycisphaeraceae → Poriferisphaera → Poriferisphaera corsica | 3395 | Open in IMG/M |
| 3300031746|Ga0315293_10858839 | Not Available | 659 | Open in IMG/M |
| 3300031758|Ga0315907_10767075 | Not Available | 724 | Open in IMG/M |
| 3300031758|Ga0315907_11069600 | Not Available | 576 | Open in IMG/M |
| 3300031772|Ga0315288_11587957 | Not Available | 534 | Open in IMG/M |
| 3300031857|Ga0315909_10520755 | Not Available | 815 | Open in IMG/M |
| 3300031857|Ga0315909_10938276 | Not Available | 529 | Open in IMG/M |
| 3300031885|Ga0315285_10818857 | Not Available | 581 | Open in IMG/M |
| 3300031951|Ga0315904_11033179 | Not Available | 648 | Open in IMG/M |
| 3300031951|Ga0315904_11195949 | Not Available | 584 | Open in IMG/M |
| 3300031952|Ga0315294_11353996 | Not Available | 566 | Open in IMG/M |
| 3300031963|Ga0315901_10282432 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1385 | Open in IMG/M |
| 3300031963|Ga0315901_10688962 | Not Available | 759 | Open in IMG/M |
| 3300032018|Ga0315272_10101355 | Not Available | 1331 | Open in IMG/M |
| 3300032046|Ga0315289_10790865 | Not Available | 838 | Open in IMG/M |
| 3300032050|Ga0315906_10892431 | Not Available | 683 | Open in IMG/M |
| 3300032053|Ga0315284_11843903 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 621 | Open in IMG/M |
| 3300032092|Ga0315905_11377594 | Not Available | 562 | Open in IMG/M |
| 3300032093|Ga0315902_10285879 | Not Available | 1573 | Open in IMG/M |
| 3300032360|Ga0315334_10982162 | Not Available | 731 | Open in IMG/M |
| 3300032397|Ga0315287_10527150 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1402 | Open in IMG/M |
| 3300033416|Ga0316622_100434737 | Not Available | 1483 | Open in IMG/M |
| 3300033418|Ga0316625_100365315 | Not Available | 1069 | Open in IMG/M |
| 3300033816|Ga0334980_0071249 | Not Available | 1458 | Open in IMG/M |
| 3300033978|Ga0334977_0137077 | Not Available | 1278 | Open in IMG/M |
| 3300033978|Ga0334977_0468719 | Not Available | 578 | Open in IMG/M |
| 3300033993|Ga0334994_0392912 | Not Available | 672 | Open in IMG/M |
| 3300034073|Ga0310130_0028555 | Not Available | 1729 | Open in IMG/M |
| 3300034092|Ga0335010_0219824 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1143 | Open in IMG/M |
| 3300034106|Ga0335036_0079630 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2440 | Open in IMG/M |
| 3300034117|Ga0335033_0568455 | Not Available | 532 | Open in IMG/M |
| 3300034272|Ga0335049_0731359 | Not Available | 595 | Open in IMG/M |
| 3300034283|Ga0335007_0378639 | Not Available | 894 | Open in IMG/M |
| 3300034283|Ga0335007_0605416 | Not Available | 633 | Open in IMG/M |
| 3300034356|Ga0335048_0079319 | Not Available | 2024 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 11.19% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 9.79% |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 9.79% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 9.09% |
| Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 7.69% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 5.59% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 5.59% |
| Estuary Water | Environmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water | 4.90% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 4.20% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 4.20% |
| Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 4.20% |
| Freshwater Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic | 2.80% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 2.10% |
| Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 2.10% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 2.10% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater | 1.40% |
| Lake Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Lake Sediment | 1.40% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 1.40% |
| Lake | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Lake | 0.70% |
| Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Lake | 0.70% |
| Aquatic | Environmental → Aquatic → Freshwater → Drinking Water → Unclassified → Aquatic | 0.70% |
| Groundwater | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Groundwater | 0.70% |
| Freshwater | Environmental → Aquatic → Freshwater → Creek → Unclassified → Freshwater | 0.70% |
| Marine | Environmental → Aquatic → Marine → Coastal → Sediment → Marine | 0.70% |
| Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 0.70% |
| Seawater | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Seawater | 0.70% |
| Estuarine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine | 0.70% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 0.70% |
| Saline Water | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Water | 0.70% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.70% |
| Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Sand | 0.70% |
| Soil | Environmental → Terrestrial → Soil → Clay → Unclassified → Soil | 0.70% |
| Fracking Water | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Fracking Water | 0.70% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300002201 | Freshwater microbial communities from San Paulo Zoo lake, Brazil - SEP 2013 | Environmental | Open in IMG/M |
| 3300002408 | Freshwater microbial communities from Lake Mendota, WI, sample - 15JUL2010 deep hole epilimnion (Lake Mendota Combined assembly, ASSEMBLY_DATE=20140123) | Environmental | Open in IMG/M |
| 3300002835 | Freshwater microbial communities from Lake Mendota, WI - (Lake Mendota Combined Ray assembly, ASSEMBLY_DATE=20140605) | Environmental | Open in IMG/M |
| 3300005527 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaG | Environmental | Open in IMG/M |
| 3300005528 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel1S_2200h metaG | Environmental | Open in IMG/M |
| 3300005581 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF | Environmental | Open in IMG/M |
| 3300005584 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG HU45MSRF | Environmental | Open in IMG/M |
| 3300005662 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 4) | Environmental | Open in IMG/M |
| 3300005805 | Microbial and algae communities from Cheney Reservoir in Wichita, Kansas, USA | Environmental | Open in IMG/M |
| 3300005943 | Groundwater microbial communities from the Columbia River, Washington, USA, for microbe roles in carbon and contaminant biogeochemistry - GW-RW metaG T4_4-Nov-14 | Environmental | Open in IMG/M |
| 3300006802 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 | Environmental | Open in IMG/M |
| 3300006875 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_>0.8_DNA | Environmental | Open in IMG/M |
| 3300006916 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 | Environmental | Open in IMG/M |
| 3300007363 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_0.3_<0.8_DNA | Environmental | Open in IMG/M |
| 3300007544 | Estuarine microbial communities from the Columbia River estuary - metaG 1449B-3 | Environmental | Open in IMG/M |
| 3300007548 | Estuarine microbial communities from the Columbia River estuary - metaG 1548B-3 | Environmental | Open in IMG/M |
| 3300007560 | Estuarine microbial communities from the Columbia River estuary - metaG 1560A-02 | Environmental | Open in IMG/M |
| 3300007585 | Estuarine microbial communities from the Columbia River estuary - metaG 1562A-3 | Environmental | Open in IMG/M |
| 3300007618 | Estuarine microbial communities from the Columbia River estuary - metaG 1554A-02 | Environmental | Open in IMG/M |
| 3300007622 | Estuarine microbial communities from the Columbia River estuary - metaG 1449A-02 | Environmental | Open in IMG/M |
| 3300007639 | Estuarine microbial communities from the Columbia River estuary - metaG 1449C-02 | Environmental | Open in IMG/M |
| 3300007642 | Estuarine microbial communities from the Columbia River estuary - metaG 1548A-3 | Environmental | Open in IMG/M |
| 3300007864 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1461B_3.0um | Environmental | Open in IMG/M |
| 3300007972 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1460ABC_3.0um | Environmental | Open in IMG/M |
| 3300007973 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1460A_0.2um | Environmental | Open in IMG/M |
| 3300007974 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1460C_0.2um | Environmental | Open in IMG/M |
| 3300007992 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1461AB_0.2um | Environmental | Open in IMG/M |
| 3300008117 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0108-C-NA | Environmental | Open in IMG/M |
| 3300008264 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0108-53-LTR | Environmental | Open in IMG/M |
| 3300008266 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample HABS-E2014-0108-C-NA | Environmental | Open in IMG/M |
| 3300008450 | Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - Oct 27, 2014 all contigs | Environmental | Open in IMG/M |
| 3300009039 | Lake sediment microbial communities from Lake Baikal, Russia to study Microbial Dark Matter (Phase II) - Lake Baikal sediment 0-5 cm | Environmental | Open in IMG/M |
| 3300009059 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.703 | Environmental | Open in IMG/M |
| 3300009081 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm May2015 | Environmental | Open in IMG/M |
| 3300009146 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm March2015 | Environmental | Open in IMG/M |
| 3300009158 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_MF_MetaG | Environmental | Open in IMG/M |
| 3300009159 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG | Environmental | Open in IMG/M |
| 3300009163 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140205_XF_MetaG | Environmental | Open in IMG/M |
| 3300009183 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG | Environmental | Open in IMG/M |
| 3300010354 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_DNA | Environmental | Open in IMG/M |
| 3300010392 | Coastal sediment microbial communities from Rhode Island, USA. Combined Assembly of Gp0121717, Gp0123912, Gp0123935, Gp0139423, Gp0139424, Gp0139388, Gp0139387, Gp0139386, Gp0139385 | Environmental | Open in IMG/M |
| 3300010885 | northern Canada Lakes Co-assembly | Environmental | Open in IMG/M |
| 3300011116 | Freshwater viral communities from Lake Soyang, Gangwon-do, South Korea - SYL_2015Nov | Environmental | Open in IMG/M |
| 3300012012 | Freshwater microbial communities from Eastern Basin Lake Erie, Ontario, Canada - Station 879 - Top - Depth 1m | Environmental | Open in IMG/M |
| 3300012017 | Freshwater microbial communities from Central Basin Lake Erie, Ontario, Canada - Station 1208 - Top - Depth 1m | Environmental | Open in IMG/M |
| 3300012708 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES113 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012769 | Freshwater microbial communities from Lake Montjoie, Canada - M_140205_X_mt (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300013004 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES118 metaG | Environmental | Open in IMG/M |
| 3300013005 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES117 metaG | Environmental | Open in IMG/M |
| 3300013126 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_022012_10m | Environmental | Open in IMG/M |
| 3300013372 | Freshwater microbial communities from Lake Erie, Ontario, Canada. Combined Assembly of 10 SPs | Environmental | Open in IMG/M |
| 3300014208 | Groundwater microbial communities from an aquifer near a municipal landfill in Southern Ontario, Canada - Groundwater well OW334 metaG | Environmental | Open in IMG/M |
| 3300014801 | Aquatic microbial communities from drinking water treatment system in Nanjing, China - Filtered water - FW | Environmental | Open in IMG/M |
| 3300017701 | Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MM110.S.N | Environmental | Open in IMG/M |
| 3300017747 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MLB.S.N | Environmental | Open in IMG/M |
| 3300017774 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.D | Environmental | Open in IMG/M |
| 3300017785 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.D.N | Environmental | Open in IMG/M |
| 3300018067 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_5_coex | Environmental | Open in IMG/M |
| 3300019784 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.D | Environmental | Open in IMG/M |
| 3300020161 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_101 megahit1 | Environmental | Open in IMG/M |
| 3300020204 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015008 Mahale S9 surface | Environmental | Open in IMG/M |
| 3300020549 | Freshwater microbial communities from Lake Mendota, WI - 12OCT2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020550 | Freshwater microbial communities from Lake Mendota, WI - 08OCT2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020555 | Freshwater microbial communities from Lake Mendota, WI - 10AUG2009 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300021141 | Freshwater microbial communities from Lake Mendota, WI - Practice 15JUN2010 epilimnion | Environmental | Open in IMG/M |
| 3300021963 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_657D | Environmental | Open in IMG/M |
| 3300022748 | Freshwater microbial communities from McNutts Creek, Athens, Georgia, United States - 20-17_Aug_MG | Environmental | Open in IMG/M |
| 3300024346 | Whole water sample coassembly | Environmental | Open in IMG/M |
| 3300025585 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025732 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025818 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_15_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025843 | Lake sediment microbial communities from Lake Baikal, Russia to study Microbial Dark Matter (Phase II) - Lake Baikal sediment 0-5 cm (SPAdes) | Environmental | Open in IMG/M |
| 3300025848 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300027138 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Cont_RepB_0h | Environmental | Open in IMG/M |
| 3300027141 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Law_RepB_8h | Environmental | Open in IMG/M |
| 3300027148 | Freshwater microbial communities from St. Lawrence River, New York, United States - Law_Law_RepB_8h | Environmental | Open in IMG/M |
| 3300027153 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Colum_RepC_8h | Environmental | Open in IMG/M |
| 3300027156 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Atlam_RepA_8h | Environmental | Open in IMG/M |
| 3300027205 | Estuarine microbial communities from the Columbia River estuary - metaG 1449B-3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027210 | Estuarine microbial communities from the Columbia River estuary - metaG 1449C-3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027214 | Estuarine microbial communities from the Columbia River estuary - metaG 1449A-02 (SPAdes) | Environmental | Open in IMG/M |
| 3300027224 | Estuarine microbial communities from the Columbia River estuary - metaG 1449C-02 (SPAdes) | Environmental | Open in IMG/M |
| 3300027594 | Freshwater microbial communities from St. Lawrence River, New York, United States - Law_Colum_RepA_8h | Environmental | Open in IMG/M |
| 3300027659 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF (SPAdes) | Environmental | Open in IMG/M |
| 3300027732 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.DD (SPAdes) | Environmental | Open in IMG/M |
| 3300027782 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027785 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SN (SPAdes) | Environmental | Open in IMG/M |
| 3300027808 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.DD (SPAdes) | Environmental | Open in IMG/M |
| 3300027971 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027972 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 10-12cm September2015 (SPAdes) | Environmental | Open in IMG/M |
| 3300028298 | Saline water microbial communities from Sakinaw Lake, British Columbia, Canada - sak_2011_5_24_40m | Environmental | Open in IMG/M |
| 3300031539 | Soil microbial communities from Risofladan, Vaasa, Finland - UN-3 | Environmental | Open in IMG/M |
| 3300031746 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G13_20 | Environmental | Open in IMG/M |
| 3300031758 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA123 | Environmental | Open in IMG/M |
| 3300031772 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G11_20 | Environmental | Open in IMG/M |
| 3300031857 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA125 | Environmental | Open in IMG/M |
| 3300031885 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G09_36 | Environmental | Open in IMG/M |
| 3300031951 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA120 | Environmental | Open in IMG/M |
| 3300031952 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G13_40 | Environmental | Open in IMG/M |
| 3300031963 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA116 | Environmental | Open in IMG/M |
| 3300032018 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C3_middle | Environmental | Open in IMG/M |
| 3300032046 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G11_40 | Environmental | Open in IMG/M |
| 3300032050 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA122 | Environmental | Open in IMG/M |
| 3300032053 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G09_16 | Environmental | Open in IMG/M |
| 3300032092 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA121 | Environmental | Open in IMG/M |
| 3300032093 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA117 | Environmental | Open in IMG/M |
| 3300032360 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 500m 34915 | Environmental | Open in IMG/M |
| 3300032397 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G11_0 | Environmental | Open in IMG/M |
| 3300033416 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_OW2_C1_D5_C | Environmental | Open in IMG/M |
| 3300033418 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_T1_C1_D1_A | Environmental | Open in IMG/M |
| 3300033816 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME16Sep2004-rr0005 | Environmental | Open in IMG/M |
| 3300033978 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME28Sep2014-rr0002 | Environmental | Open in IMG/M |
| 3300033993 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Jul2012-rr0037 | Environmental | Open in IMG/M |
| 3300034062 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Jul2012-rr0045 | Environmental | Open in IMG/M |
| 3300034073 | Fracking water microbial communities from deep shales in Oklahoma, United States - MC-6-XL | Environmental | Open in IMG/M |
| 3300034092 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME03Aug2012-rr0069 | Environmental | Open in IMG/M |
| 3300034106 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME23Aug2013-rr0131 | Environmental | Open in IMG/M |
| 3300034117 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Jun2014-rr0124 | Environmental | Open in IMG/M |
| 3300034272 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Jul2017-rr0156 | Environmental | Open in IMG/M |
| 3300034283 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07Aug2003-rr0061 | Environmental | Open in IMG/M |
| 3300034356 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Jun2014-rr0152 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| metazooDRAFT_12715231 | 3300002201 | Lake | MADTKITALSAITTVDPANDVLPIVDVSDTSMAASGTTKKITT |
| B570J29032_1090609091 | 3300002408 | Freshwater | MADSKITALTALTAADPVNDMFPVVDVSDTSMAASGTTKRISAN |
| B570J29032_1096787141 | 3300002408 | Freshwater | MADTKITALAAITTVDPAADVLPIVDISDTSMAASGTTKKITSNQILGAG |
| B570J40625_1002910241 | 3300002835 | Freshwater | MADTKITALTAISTVDPAVDVLPIVDVSDTTMAASGTTKKITSNQIL |
| B570J40625_1015952993 | 3300002835 | Freshwater | MPDAKITALTAISVIDPAVDPLPIVDVSDTAMAASGTTKKITINQ |
| Ga0068876_102572284 | 3300005527 | Freshwater Lake | MADTKITALAAITTVDPAADVLPIVDVSDTSMAASGT |
| Ga0068872_103904503 | 3300005528 | Freshwater Lake | MADTKITALSALTAADPANDVLPIVDVNDPFMATSGTTKKISINNILGASGTAT |
| Ga0049081_101687454 | 3300005581 | Freshwater Lentic | MPDTKITALTALTTADPANDMMPIVDVSDTSMAASGTTKRISINNLLACSPSA |
| Ga0049081_102128091 | 3300005581 | Freshwater Lentic | MADAKISALTNLTAADAINDMIPIVDVSDTPPASGNTKRISIN |
| Ga0049082_100437381 | 3300005584 | Freshwater Lentic | MADVKITSLTALTAADPANDVIPIVDVSDTTMAASG |
| Ga0078894_116842513 | 3300005662 | Freshwater Lake | MPDSKITALASIGTGTDPANDPLVVVDVSDTSMAASGTTKKVTL |
| Ga0079957_10793905 | 3300005805 | Lake | MPDSKITALTSIGASTDPANDPLVLVDVSDTSMAASGTTKKVTLNQL |
| Ga0073926_100142825 | 3300005943 | Sand | MADTKITALAAITVVDPAADVLPIVDISDTSMAASGTTK |
| Ga0070749_102555651 | 3300006802 | Aqueous | MADSKITALTSIGASTDPANDPLVLVDVSDTSMAASGTT |
| Ga0070749_104771071 | 3300006802 | Aqueous | MPDTKITALTAISTVDPALDVLPIVDVSDTTMAASGTTKKITSNQILG |
| Ga0070749_105204281 | 3300006802 | Aqueous | MADTKITALSALTAADPANDVLPIVDVNDPFMAASGTTKKISINNILGASGTA |
| Ga0070749_105249631 | 3300006802 | Aqueous | MPDSKITALTSISTSTDPANDPLVIVDVSDTSMAATG |
| Ga0070749_107057881 | 3300006802 | Aqueous | VADVKITGLAPITVLDPAVDPLPIVDVSDTSMSPTGTTKKVTVAQL |
| Ga0075473_100015091 | 3300006875 | Aqueous | MADSKITALTSIGASTDPANDPLVLVDVSDTSMAA |
| Ga0075473_100583111 | 3300006875 | Aqueous | MPDSKITALTSISTSTDPANDPLVIVDVSDTSMAATGTTKKV |
| Ga0070750_104780043 | 3300006916 | Aqueous | MADSKITALTSIGASTDPANDPLVLVDVSDTSMAASGTTKKVTL |
| Ga0075458_102342383 | 3300007363 | Aqueous | MADTKITALTAITTVDPAVDVFPIVDVSDTTMAASG |
| Ga0102861_12322243 | 3300007544 | Estuarine | MADSKITALTALTAADPANDMIPIVDVSDTPPASGNTKRISINNILACSPSATL |
| Ga0102877_10705791 | 3300007548 | Estuarine | MPDTKITALTALTAADPANDMMPIVDVSDTSMAASGTTKRISINNILACS |
| Ga0102913_12107383 | 3300007560 | Estuarine | MADSKITALTALTAADPVNDMFPVVDVSDTTMAASGTTKKISVN |
| Ga0102916_12296633 | 3300007585 | Estuarine | MPDTKITALAAITTVAPANDLFAIVDVSDNSMAASGTT |
| Ga0102896_12374783 | 3300007618 | Estuarine | MADVKITALAVLTAADPINDAIPIVDVSDFTMAASGTTKRISVNNILSSSPT |
| Ga0102863_10433615 | 3300007622 | Estuarine | MPDTKITALAAITTVAPANDLFPIVDVSDNSMAASGTTKNIT |
| Ga0102865_11357451 | 3300007639 | Estuarine | MADSKITALGNLTAADPVNDMFPIVDVNDFTMAASG |
| Ga0102876_11534771 | 3300007642 | Estuarine | MADSKITALTALTAADPVNDMFPVVDVSDTTMAASGTTKK |
| Ga0105749_10967691 | 3300007864 | Estuary Water | MPASDLKITALNPIVTVDPAADVLPIVDISDNSMAASG |
| Ga0105745_11300291 | 3300007972 | Estuary Water | MADTKITALAAIATVDPAADVLPIVDISDTSMAASGTTKKVTV |
| Ga0105746_10995031 | 3300007973 | Estuary Water | MPDTKITALAAITTVAPANDLFPIVDVSDNSMAASGTTKNITVNQLLGS |
| Ga0105747_12625113 | 3300007974 | Estuary Water | MPDSKITALTALTAADPANDMIPIVDVSDTPPASGNTKRISINNILACSP |
| Ga0105747_13334712 | 3300007974 | Estuary Water | MADVKITALAVLTAADPINDAIPIVDVSDATMAASGTTKRISVNNILSS |
| Ga0105748_101532141 | 3300007992 | Estuary Water | MADAKISALTNLTAADAINDMIPIVDVSDTPPASGNTKRISINNI |
| Ga0105748_104637253 | 3300007992 | Estuary Water | MADVKITALTALTAADPANDAIPIVDASDTTMAASGTTK |
| Ga0114351_10476141 | 3300008117 | Freshwater, Plankton | MPDSKITALTSISTSTDPANDPLVIVDVSDTSMAATGTTKKVTLNQ |
| Ga0114353_13778023 | 3300008264 | Freshwater, Plankton | MPDTKITALTALTAADPANDVLPIVDVSDTTMAASGTTKKISINNVLGCSGTA |
| Ga0114363_10905731 | 3300008266 | Freshwater, Plankton | MADSKITALTAISTVDPTADPLVIVDVSDTSMAASGTTKKGTI |
| Ga0114880_11513331 | 3300008450 | Freshwater Lake | MPDTKITALTAITTVDPAVDVLPIVDVSDTTMAASGTTKKIT |
| Ga0114880_12745802 | 3300008450 | Freshwater Lake | MADVKITALGVLTAADPINDAIPIVDVSDNSMAASGTTKRIS |
| Ga0105152_101400081 | 3300009039 | Lake Sediment | MPAQDTKITALAAIATVDPAADVLPIVDISDTSMAASGTTKKITSNQILG |
| Ga0102830_11070691 | 3300009059 | Estuarine | MADAKISALDNLTAADAINDMIPIVDVSATPPASGNTKRISINNI |
| Ga0105098_100614935 | 3300009081 | Freshwater Sediment | MADTKITALAAITTVDPAADVLPIVDISDTSMAASGTT |
| Ga0105091_103355631 | 3300009146 | Freshwater Sediment | MADTKITALTAISTVDPAVDVLPIVDVSDTTMAAS |
| Ga0114977_104348534 | 3300009158 | Freshwater Lake | MADVKITALAVLTAADPINDAIPIVDVSDVTITASGT |
| Ga0114978_106303063 | 3300009159 | Freshwater Lake | MADTKITALTALTAADPANDVIPIVDVSDTTMAASG |
| Ga0114970_107404823 | 3300009163 | Freshwater Lake | MADAKISALTNLTAADAINDMIPIVDVSDSPPASGNTKRI |
| Ga0114974_105514791 | 3300009183 | Freshwater Lake | MPDSKITALTSIGTSTDPANDPLVIVDVSDTSMAASGTTKKVSLNNL |
| Ga0129333_104695431 | 3300010354 | Freshwater To Marine Saline Gradient | MPDTKITALTALTTADPANDMMPIVDVSDTSMAASGTTKRISINNILACSPS |
| Ga0118731_1096195651 | 3300010392 | Marine | MADSKITALTAGTVISSGDPFVYVDISDTSMDAGGTTKKIDID |
| Ga0133913_112200881 | 3300010885 | Freshwater Lake | MADSKITALTNLTAADPVNDMLPIVDVSDTTMAASGTTKRIS |
| Ga0151516_1074617 | 3300011116 | Freshwater | MADTKITALAAITTVAPANDLFAIVDVSDNSMAASGTTKNITTNQI |
| Ga0153799_10526251 | 3300012012 | Freshwater | MADLKISELNNLTGADPILDMLPIVDVSATPPASGST |
| Ga0153799_10537464 | 3300012012 | Freshwater | MASKKITELGPISTIDTAVDPLPIVDVSDTSMAASGTTKKVTVSQIASAIYAAN |
| Ga0153801_10428201 | 3300012017 | Freshwater | MPDTKITALTALTAADPANDVLPIVDVSDTTMAASGTTKKISINNVLGCSGTATL |
| Ga0157595_10327851 | 3300012708 | Freshwater | MADVKITALGVLTAADPINDAIPIVDVSDNSMAASGTTKRISVNNIL |
| Ga0138279_12126731 | 3300012769 | Freshwater Lake | MADTKITALAAIATVDPAADVLPIVDISDTSMAASGTTKKITSNQILG |
| Ga0164293_108326581 | 3300013004 | Freshwater | MPDTKITALTALTAADPANDMMPIVDVSDTSMAASGTTKRISINN |
| Ga0164292_105997053 | 3300013005 | Freshwater | MPDTKITALTALTAADPANDMVPIVDVSDNSMAASGTTKRISINNILACSPSAT |
| (restricted) Ga0172367_102392225 | 3300013126 | Freshwater | MPDTKITALTALTAADPANDVLPIVDVSDTTMAASGTTKKIS |
| Ga0177922_101195681 | 3300013372 | Freshwater | MPDTKITALTALTAADPANDVLPIVDVSDTTMAASGTTKKISINNV |
| Ga0172379_100501704 | 3300014208 | Groundwater | MADTKITGLGESTAPDDADVFPNVDVSDTSMAATG |
| Ga0119946_10126684 | 3300014801 | Aquatic | MPDTKITALTALTAADPANDVLPIVDVSDTTMAASGTTKKISINN |
| Ga0181364_10602343 | 3300017701 | Freshwater Lake | MADVKITALTALTAADPANDVIPIVDVSDTTMAASGTTKK |
| Ga0181352_10465961 | 3300017747 | Freshwater Lake | MADTKITALTALTAADPANDVIPIVDVSDTSMAASGTTKK |
| Ga0181352_10812861 | 3300017747 | Freshwater Lake | MADSKITALTALTAADPANDMMPIVDVSDTSMAASGT |
| Ga0181352_10950151 | 3300017747 | Freshwater Lake | MEDTKITALTAITTVDPAVDVLPIVDVSDTTMAASGTTKKIT |
| Ga0181358_10867831 | 3300017774 | Freshwater Lake | MADLKISELTNLTAADPVSDMLPIVDVSATPPASGS |
| Ga0181355_10518365 | 3300017785 | Freshwater Lake | MADSTITALTALTAADPVNDMFPVVDVSDTTMAASGTTKKI |
| Ga0181355_12047461 | 3300017785 | Freshwater Lake | MADSKITALTALTAADPANDMMPIVDVSDTSMAASGTTKRISINNILACSP |
| Ga0184611_11812851 | 3300018067 | Groundwater Sediment | VADSKITDLAALTGANAAVGDKLIVVDISDTSMAASGTDKSITLAE |
| Ga0181359_11053074 | 3300019784 | Freshwater Lake | MADTKITALAAITVVDPAADVLPIVDISDTSMAASGTTKKITSNQILGSGGTA |
| Ga0211726_108882595 | 3300020161 | Freshwater | MADSKITALAALTTADPANDMFPVVDVSDTSMAASGTTKRISA |
| Ga0194116_102673551 | 3300020204 | Freshwater Lake | MADTKITALAAITTVDPAADVLPIVDISDTSMAASGTTKKITSNQLL |
| Ga0207942_10226141 | 3300020549 | Freshwater | MADSKITALTALTAADPVNDMFPVVDVSDTTMAASGTTKKI |
| Ga0208600_10269674 | 3300020550 | Freshwater | MADSKITALTALTAADPVNDMFPVVDVSDTSMAASGTTKRIS |
| Ga0208358_10254941 | 3300020555 | Freshwater | MADTKITALTAITTVDPAVDVLPIVDISDTTMAAS |
| Ga0214163_10782454 | 3300021141 | Freshwater | MPDSKITALASTGTGTDPANDPLVIVDVSDTSMAA |
| Ga0222712_103717414 | 3300021963 | Estuarine Water | MPDSKITALTSIGASTDPANDPLVLVDVSDTSMAASGT |
| Ga0228702_11388301 | 3300022748 | Freshwater | MLATKITELTAISTIDVSVDPLAIVDVSDTTQASSGTTKKVTVSQIASAIYSAN |
| Ga0244775_112367781 | 3300024346 | Estuarine | MADSKITGLSSIGTGADRNNDQLVIVDVSDTTMASTGT |
| Ga0208546_11235343 | 3300025585 | Aqueous | MADSKITALTSIGASTDPANDPLVLVDVSDTSMAASGTTKKVTLNQ |
| Ga0208784_10965111 | 3300025732 | Aqueous | MADSKITALTSIGASTDPANDPLVLVDVSDTSMAATGTTKKV |
| Ga0208542_11516573 | 3300025818 | Aqueous | MPDSKITALTSIGASTDPANDPLVLVDVSDTSMAASGTTKKVTLNQLL |
| Ga0209182_100653955 | 3300025843 | Lake Sediment | MADTKITALTALTAADPANDVIPIVDVSDPTMAASG |
| Ga0208005_11749291 | 3300025848 | Aqueous | MPDSKITALTSIGASTDPANDPLVLVDVSDTSMAASGTTKKVTLN |
| Ga0255064_10390541 | 3300027138 | Freshwater | MPDTKITALAAITTVAPANDLFAIVDVSDNSMAASGTTKN |
| Ga0255076_10384901 | 3300027141 | Freshwater | MPDTKITALAAITTVAPANDLFAIVDVSDNSMAASGTTKNITTNQILGAGGT |
| Ga0255115_10725621 | 3300027148 | Freshwater | MADTKITALAAITTVDPAADVLPIVDISDTSMAASGTTK |
| Ga0255083_10155181 | 3300027153 | Freshwater | MPDTKITALAAITTVAPANDLFAIVDVSDNSMAASGTTKNITTN |
| Ga0255078_10076111 | 3300027156 | Freshwater | MPDTKITALAAITTVAPANDLFAIVDVSDNSMAASGTTKNITTNQILG |
| Ga0208926_10040121 | 3300027205 | Estuarine | MADTKITALAAIATVDPAADVLPIVDISDTSMAASGTTKKVTTNQILQ |
| Ga0208802_10021537 | 3300027210 | Estuarine | MADTKITALTALTAADPANDVIPIVDVSDTTMAASGT |
| Ga0208306_10107125 | 3300027214 | Estuarine | MADTKITALAAIATVDPAADVLPIVDISDTSMAASGTTKKVT |
| Ga0208164_10166981 | 3300027224 | Estuarine | MADTKITALAAIATVDPAADVLPIVDISDTSMAASGTTKKVTTNQILQA |
| Ga0208164_10880371 | 3300027224 | Estuarine | MPASDLKITALNPIVTVDPAADVLPIVDISDTSMAASGTTKKV |
| Ga0255120_10266385 | 3300027594 | Freshwater | MADTKITALAAITTVDPAADVLPIVDISDTSMAASGTTKKITSNQIL |
| Ga0208975_10447466 | 3300027659 | Freshwater Lentic | MPDTKITALTALTAADPANDVLPIVDVSDTTMAASGTTKKISIN |
| Ga0209442_11819321 | 3300027732 | Freshwater Lake | MADTKITALAAITVVDPAADVLPIVDISDTSMAASGTTKKITSNQILGSG |
| Ga0209500_103103201 | 3300027782 | Freshwater Lake | MADSKITALTALTAADPANDMIPIVDVSDTPPASGNTKRISI |
| Ga0209246_102621313 | 3300027785 | Freshwater Lake | MADAKISALTNLTAADAINDMIPIVDVSDTPPASGNTKRISINNILSSSPTA |
| Ga0209354_103491781 | 3300027808 | Freshwater Lake | MADVKITALTALTAADPANDVIPIVDVSDTTMAASGTTKKISVN |
| Ga0209401_10896665 | 3300027971 | Freshwater Lake | MADTKITALAAIATVDPAADVLPIVDISDTSMAASGTTKKI |
| Ga0209079_101531001 | 3300027972 | Freshwater Sediment | MADTKITALTAITTVDPAVDVLPIVDVSDTTMAASGTTK |
| Ga0268280_11854401 | 3300028298 | Saline Water | MADLKISGLTALTAADSGDLVEIVDISDTTMAATGTNKKITFAQVMASG |
| Ga0307380_100818214 | 3300031539 | Soil | MPDAKITDLPAFSTIDPANDPFPGVDASDTAQAASGTNKAATADQI |
| Ga0315293_108588393 | 3300031746 | Sediment | MADSKITALASISTSTDPAVDPLVIVDVSDTSMAASGT |
| Ga0315907_107670753 | 3300031758 | Freshwater | MPDTKITALAAITTVAPANDLFAIVDVSDNSMAASGTTKNITTNQILGAG |
| Ga0315907_110696003 | 3300031758 | Freshwater | MADTKITALTAISTVDPAVDVLAIVDVSDTTMAASGTTKKITSNQLL |
| Ga0315288_115879571 | 3300031772 | Sediment | MADVKITALAVLTAADPINDAIPIVDVSDITMAASGTTKRISVNNILSSSPTASGALTVT |
| Ga0315909_105207551 | 3300031857 | Freshwater | MPDSKITALTSISTSTDPANDPLVIVDVSDTSMAATGTTK |
| Ga0315909_109382763 | 3300031857 | Freshwater | MPDTKITALAAITTVAPANDLFAIVDVSDNSMAASGTTKNITTNQIL |
| Ga0315285_108188573 | 3300031885 | Sediment | MADSKITALASISTSTDPAVDPLVIVDVSDTSMAA |
| Ga0315904_110331791 | 3300031951 | Freshwater | MPDTKITALTALTTADPANDMMPIVDVSDTSMAASG |
| Ga0315904_111959493 | 3300031951 | Freshwater | MADTKITALTAITTVDPANDVLPIVDVSDTSMAASGTTKKITTNQ |
| Ga0315294_113539963 | 3300031952 | Sediment | MADSKITALTALTAADPVNDMFPVVDVSDTSMAASGTTK |
| Ga0315901_102824325 | 3300031963 | Freshwater | MADLKISELTNLTAADPANDMIPIVDVSATPPASGSTKRISINNILACSPTATL |
| Ga0315901_106889624 | 3300031963 | Freshwater | MADTKITALTALTAADPASDVLPIVDISDTTMAASGTTKKISVNNI |
| Ga0315272_101013555 | 3300032018 | Sediment | MAYTKITALTALTAADPANDVIPIVDVSDTTMAASGTTK |
| Ga0315289_107908654 | 3300032046 | Sediment | MADSKITALAALTAADPVNDMFPVVDVSDTSMAASGTTKRISVNNI |
| Ga0315906_108924311 | 3300032050 | Freshwater | MPDAKITALTAISVIDPAVDPLPIVDVSDTAMAASGTTKKI |
| Ga0315284_118439033 | 3300032053 | Sediment | MADTKITALAAIATVDPAADVLPIVDISDTSMAATGT |
| Ga0315905_113775943 | 3300032092 | Freshwater | MPDTKITALTALTAADPANDVLPIVDVSDTTMAAS |
| Ga0315902_102858791 | 3300032093 | Freshwater | MADSKITALTALTAADPANDMIPIVDVSDTPPASGNTKRISINNLLACSPSA |
| Ga0315334_109821621 | 3300032360 | Seawater | MADQKITQLTELSAQPASTDVLPIVDIDDTTMAGSGTTKKISVTNLLAS |
| Ga0315287_105271505 | 3300032397 | Sediment | MADLKISELNNLTAADPILDMLPIVDVSATPPASGSTKRISINNILSSSPTA |
| Ga0316622_1004347371 | 3300033416 | Soil | MADTKITALTAITTVDPAVDVLPIVDVSDTTMAASGTT |
| Ga0316625_1003653151 | 3300033418 | Soil | MPDTKITALTALTAADPANDVLPIVDVSDTTMAASGTTKKISI |
| Ga0334980_0071249_1313_1456 | 3300033816 | Freshwater | MADTKITALTAISTVDPAVDVLPIVDVSDTTMAASGTTKKITSNQILG |
| Ga0334977_0137077_1_129 | 3300033978 | Freshwater | MADTKITALTAITTVDPAVDVLPIVDVSDTTMAASGTTKKITS |
| Ga0334977_0468719_2_115 | 3300033978 | Freshwater | MADSKITALTAISTVDPTADPLVIVDVSDTSMAASGTT |
| Ga0334994_0392912_529_672 | 3300033993 | Freshwater | MPDTKITALTALTAADPANDMMPIVDVSDTSMAASGTTKRISINNILA |
| Ga0334995_0702749_2_133 | 3300034062 | Freshwater | MADLKISELTNLTAADPVSDMLPIVDVSATPPASGSTKRISINN |
| Ga0310130_0028555_1594_1728 | 3300034073 | Fracking Water | MPDSKITALTSISTSTDPANDPLVIVDLSDTSMAATGTTKKVTLN |
| Ga0335010_0219824_2_136 | 3300034092 | Freshwater | MADTKITALAAITTVDPAADVLPIVDISDTSMAASGTTKKITSNQ |
| Ga0335036_0079630_3_146 | 3300034106 | Freshwater | MADTKITALAAITTVDPAADVLPIVDISDTSMAASGTTKKITSNQILG |
| Ga0335033_0568455_1_120 | 3300034117 | Freshwater | MADSKITALTALTAADPANDMMPIVDVSDTSMAASGTNKR |
| Ga0335049_0731359_3_110 | 3300034272 | Freshwater | MADSKITALTAISTVDPTADPLVIVDVSDTSMAASG |
| Ga0335007_0378639_3_146 | 3300034283 | Freshwater | MADAKISALTNLTAADAINDMIPIVDVSDTPPASGNTKRISINNLLSS |
| Ga0335007_0605416_2_115 | 3300034283 | Freshwater | MADTKITALTALTTADPANDMMPIVDVSDTTMAASGTT |
| Ga0335048_0079319_1_138 | 3300034356 | Freshwater | MADAKISALTNLTAADAINDMIPIVDVSDTPPASGNTKRISINNLL |
| ⦗Top⦘ |