NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0247532_100491

Scaffold Ga0247532_100491


Overview

Basic Information
Taxon OID3300031827 Open in IMG/M
Scaffold IDGa0247532_100491 Open in IMG/M
Source Dataset NameMetatranscriptome of spruce litter microbial communities from Bohemian Forest, Czech Republic - CLI4 (Metagenome Metatranscriptome)
Source Dataset CategoryMetatranscriptome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1153
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil → Soil, Plant Litter And Rhizosphere Microbial Communities From European Coniferous Forests

Source Dataset Sampling Location
Location NameCzech Republic: South Bohemian Region
CoordinatesLat. (o)49.0427Long. (o)13.6161Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F074242Metagenome / Metatranscriptome119N

Sequences

Protein IDFamilyRBSSequence
Ga0247532_1004911F074242GAGGVLGGGGRRSSLQPPAFIPTLSLSHKFRYENGGNSGTFNITRGNLLNQILIATSTTTTVRIIQAIRLKSVEVWGSPPALGSAPTDIQVEWLGENSPSTVVSDTSMGIRPSHVATSPPPSSSNKWWSISGTSEGDVLFSITLPTESVIDVNCELRLVEKEAPIAGDAAVAATLGQVYGDYLDGIASGKLVPSGFTFLP

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.