Scaffold Ga0307413_10007756

Overview

Basic Information

• Taxon OID: 3300031824
• Scaffold ID: Ga0307413_10007756
• Source Dataset Name: Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 5011
• Total Scaffold Genes: 9
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 8 (88.89%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere → Maize Rhizosphere Microbial Communities From Greenhouse At Uc Davis, California, United States

Source Dataset Sampling Location

• Location Name: USA: California
• Coordinates
  • Lat. (^o): 38.5
  • Long. (^o): -121.7

Associated Families

Family	Category	Number of Sequences	3D Structure?
F033476	Metagenome	177	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0307413_100077563	F033476	AGGAG	MFQYRLFSHDGLGNFSLLHEFKAQDDEAAARLVGRWGPGPFELWQSSRRVHQGT