NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0310125_10111600

Scaffold Ga0310125_10111600


Overview

Basic Information
Taxon OID3300031811 Open in IMG/M
Scaffold IDGa0310125_10111600 Open in IMG/M
Source Dataset NameMarine microbial communities from Western Arctic Ocean, Canada - CB11b_Tmax_Bot8
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1436
Total Scaffold Genes4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (25.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Microbial Communities From Western Arctic Ocean, Canada

Source Dataset Sampling Location
Location NameCanada: Western Arctic Ocean
CoordinatesLat. (o)79.9957Long. (o)-149.9767Alt. (m)Depth (m)432
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F084715Metagenome / Metatranscriptome112Y

Sequences

Protein IDFamilyRBSSequence
Ga0310125_101116001F084715N/AFKHPAAPAPIATKIIPIIASEIFIFELEVNNPTAQVNITRDITLGFMSDTKDLI

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.