NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0326513_10034019

Scaffold Ga0326513_10034019


Overview

Basic Information
Taxon OID3300031760 Open in IMG/M
Scaffold IDGa0326513_10034019 Open in IMG/M
Source Dataset NameBovine rumen microbial communities from UC Davis, California, United States - 2_2465_0518
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)3854
Total Scaffold Genes11 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (18.18%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Neisseriales → Neisseriaceae → unclassified Neisseriaceae → Neisseriaceae bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Mammals → Digestive System → Foregut → Rumen → Rumen → Rumen Microbial Communities From Sheep, Dairy Cows And Beef Cattle From Various Locations

Source Dataset Sampling Location
Location NameUSA: California
CoordinatesLat. (o)38.5357Long. (o)-121.7593Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F057035Metagenome / Metatranscriptome136Y
F064301Metagenome / Metatranscriptome128Y
F079361Metagenome / Metatranscriptome116Y

Sequences

Protein IDFamilyRBSSequence
Ga0326513_100340194F079361N/AMIYFTIAKNDCGYLIDSISECYEVLKAKFPDEKIYKSDKPIVSIYVLKDQLNEI
Ga0326513_100340196F064301N/AMAKAKGITARTVSGPTKVPPVWQIGILFPDGKKISKPKCTLNEIFETYFIGLDKYLSKGLTAEELLNKYKETFESKGIKVAIHYIDSWSHIWKGKVAWPRESKFIEYLNKRLNENYS
Ga0326513_100340199F057035N/AMTEKEFLEKRIPIWLEGDDLHISRPSSTDANDMHAFLAKKYGYNWIFAIRGYYWPGSHVQLYLGDYETVNCTILVTSYIFNYFPDIKYIGIGCDKGKPGEIWPAKIWIGRDKSCMNPELFNNEK
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.